Align ABC transporter for D-Glucosamine, permease component 2 (characterized)
to candidate Synpcc7942_0949 Synpcc7942_0949 permease protein of sugar ABC transporter
Query= reanno::Smeli:SM_b21220 (293 letters) >FitnessBrowser__SynE:Synpcc7942_0949 Length = 292 Score = 195 bits (495), Expect = 1e-54 Identities = 108/264 (40%), Positives = 152/264 (57%), Gaps = 1/264 (0%) Query: 13 LMLPLLVVMTAVIGWPLVDTVRLSFTDAKL-VGTEGGFVGTANYIKMLGGSNFQRALVTT 71 L +P L+ +T V +PL+ LS L + F+G ANY ++ G S F L T Sbjct: 8 LTIPALLTITGVFAYPLLRAAWLSLQALNLNTQLQPVFIGLANYQRLWGDSRFWGDLFNT 67 Query: 72 TWFAVISVAAEMVLGVLAALLLNQQFRGRTALRALMILPWALPTVVNATLWRLIYNPEYG 131 T F V SV+ E+VLG+ ALLL+Q R R LR + +LPW LPT V A W I+N YG Sbjct: 68 TVFTVTSVSLELVLGLAIALLLHQPSRWRGPLRTIALLPWVLPTAVMALGWAWIFNDPYG 127 Query: 132 ALNAALTQLGLLDSYRSWLGEPGTALAALIVADCWKNFPLVALIALAALQAVPRDITAAS 191 N L QLG + + +WLG P A L+ AD WK P VA++ LA QA+P D+ A Sbjct: 128 VWNDWLQQLGWIAAPINWLGNPRWAWLTLVAADVWKTTPFVAILLLAGRQAIPEDLYEAH 187 Query: 192 LVDGAGPFNRFRFVIMPYLAGPLLVALVLRTIEAFKVFDIIWVMTRGGPANSTRTLSILV 251 ++GA + F + +P L L +AL+ R+ +AF +FD++ VMT GGPANST TL++ Sbjct: 188 CLEGATAWQSFWQITLPLLRPQLAIALLFRSAQAFGLFDLVKVMTGGGPANSTETLALYA 247 Query: 252 YQEAFSFQRAGSGASLALIVTLLV 275 Y A + G GA+LA++ ++ Sbjct: 248 YTTALRYLDFGYGATLAIVTAAIL 271 Lambda K H 0.326 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 292 Length adjustment: 26 Effective length of query: 267 Effective length of database: 266 Effective search space: 71022 Effective search space used: 71022 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory