Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate Synpcc7942_0947 Synpcc7942_0947 ATPase
Query= reanno::Phaeo:GFF2754 (331 letters) >FitnessBrowser__SynE:Synpcc7942_0947 Length = 355 Score = 253 bits (647), Expect = 4e-72 Identities = 141/339 (41%), Positives = 203/339 (59%), Gaps = 25/339 (7%) Query: 3 ALQLTNVCKSFGPVEV-LKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEIS 61 AL+L + K++ P V + +++L ++ GEF+ +GPSGCGKST LR+I+GL+ T+G I Sbjct: 5 ALELRQLRKAYSPSVVPVANLSLQLQPGEFLTLLGPSGCGKSTTLRLIAGLDQPTSGSIW 64 Query: 62 IGGQTVTTTPPAKRGIAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAEASRML 121 +G + +TT PP R +AMVFQSYALYPHL+VR+N+ L L+ R EI R+ + + L Sbjct: 65 LGDREITTLPPGDRDMAMVFQSYALYPHLNVRQNLTLGLQIRRTSAAEIEQRLQQVAHNL 124 Query: 122 SLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIARLHR 181 L+ LDRRP++LSGGQRQRVA+GRA+VR+P +FL DEPLSNLDA LR R ++ L Sbjct: 125 ELDHLLDRRPAQLSGGQRQRVALGRALVRQPSVFLLDEPLSNLDALLREQVRAQMKALFS 184 Query: 182 QLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFIGAPAMNF 241 Q ++ ++YVTHDQ EA++L+ +I +L G ++Q+ +P +Y PAN FVA FIG+P MN Sbjct: 185 QQASPVVYVTHDQTEALSLSHRIAILNGGHLQQLDSPDRIYQAPANAFVAGFIGSPRMNL 244 Query: 242 VP-----------------AQRLGGNPGQFIGIRPEYARISPVGPLAGEVIHV-----EK 279 +P L G+RPE+ +++ P I V E Sbjct: 245 LPLPIHSGQAWLGSRALPIPSHLAARSQVLWGLRPEHLKLAT--PEVERAIPVQLHLTEN 302 Query: 280 LGGDTNILVDMGEDLTFTARLFGQHDTNVGETLQFDFDP 318 LG + V + + RL D + LQ F+P Sbjct: 303 LGMQRLLTVAIAANPEVRLRLLMPSDQPIPTDLQVTFEP 341 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 355 Length adjustment: 29 Effective length of query: 302 Effective length of database: 326 Effective search space: 98452 Effective search space used: 98452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory