Align N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized)
to candidate Synpcc7942_1406 Synpcc7942_1406 ATPase
Query= reanno::Phaeo:GFF2754 (331 letters) >FitnessBrowser__SynE:Synpcc7942_1406 Length = 368 Score = 206 bits (525), Expect = 6e-58 Identities = 112/251 (44%), Positives = 156/251 (62%), Gaps = 12/251 (4%) Query: 4 LQLTNVCKSFG--PVEVLKDINLTVEDGEFVVFVGPSGCGKSTLLRVISGLEDATAGEIS 61 L L VCK F + + ++ +E GE + VGPSGCGK+TLLR+I+G E +G I Sbjct: 7 LCLDRVCKQFSGSSLAAVDQVSFELEAGEILGLVGPSGCGKTTLLRMIAGFESLQSGSIQ 66 Query: 62 IGGQTVTTT----PPAKRGIAMVFQSYALYPHLSVRENMALALKQERQPKEEIAARVAEA 117 + G+TV T PP R + MVFQ YAL+PHL+V +N+ L+ + AA +A Sbjct: 67 LAGETVATAQRSLPPETRSVGMVFQDYALFPHLTVLDNVCFGLRDRKGS----AAVARQA 122 Query: 118 SRMLSLEDYLDRRPSELSGGQRQRVAIGRAVVREPKLFLFDEPLSNLDAALRMNTRLEIA 177 ++ LE R P ELSGGQ+QRVA+ RA+ +P L L DEPLSNLD +R+ R E+ Sbjct: 123 LALVGLEGLERRYPHELSGGQQQRVALARALAPQPPLILLDEPLSNLDVQVRLRLRQELR 182 Query: 178 RLHRQLSASMIYVTHDQIEAMTLADKIVVLRDGRIEQVGTPMELYNNPANRFVAEFIGAP 237 + RQ A+ I VTHDQ EA+++ D++ V+R GR EQ+G P EL+ +PA+RFVAEF+ Sbjct: 183 DILRQAQATAILVTHDQEEALSICDRVAVMRLGRFEQIGQPEELFQHPASRFVAEFLS-- 240 Query: 238 AMNFVPAQRLG 248 NF+ + G Sbjct: 241 QANFLATEYQG 251 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 368 Length adjustment: 29 Effective length of query: 302 Effective length of database: 339 Effective search space: 102378 Effective search space used: 102378 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory