Align glucosamine 6-phosphate isomerase 1 (EC 3.5.99.6) (characterized)
to candidate Synpcc7942_1103 Synpcc7942_1103 glucosamine-6-phosphate isomerase 2
Query= metacyc::MONOMER-13185 (266 letters) >FitnessBrowser__SynE:Synpcc7942_1103 Length = 243 Score = 177 bits (449), Expect = 2e-49 Identities = 96/226 (42%), Positives = 136/226 (60%), Gaps = 4/226 (1%) Query: 10 ADPAIKLAHRIAEVVRSKPNCVLGLATGSTPIPVYQELARLHREEGLDFSQVRTFNLDEY 69 AD +A RIA+ ++++P+ LGLATG T +P+Y EL L++ R F LDEY Sbjct: 10 ADVIQAVADRIADRLQAQPDLSLGLATGRTMVPLYAELLG----RSLNWQHCRIFALDEY 65 Query: 70 AGLPPTHDQTYRFFMEEHLFSKVNIKPENVHFLNGMASDYEKECERYEQELKAIGPCDVW 129 GL H ++ + + ++PE V FLNG A D +E +RY + L+ G D+ Sbjct: 66 WGLATDHPSSFAAELRQRFCQPAGLRPEQVQFLNGAALDPAQESQRYRRCLEQAGGLDLQ 125 Query: 130 LLGIGHNGHIAFNEPGSPRDSRTRVVCLTQSTIDANARFFGNDKSKVPTKALSVGIATIM 189 LLG+G NGH+AFNEPGS R+SR R+V L+ T NA FG D VP+ ALS+G+A I+ Sbjct: 126 LLGLGENGHLAFNEPGSARESRVRLVQLSDRTRQQNAGAFGGDPEAVPSAALSLGLADIL 185 Query: 190 ESREILLLATGESKREAVTKSVKGKCETHCPASFLHEHPHCRFYVD 235 E+RE+L L TG SK + + ++++ T PAS+L EHP Y D Sbjct: 186 EARELLWLVTGASKTKILAQALQPPPTTAIPASYLQEHPATTLYAD 231 Lambda K H 0.319 0.133 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 243 Length adjustment: 24 Effective length of query: 242 Effective length of database: 219 Effective search space: 52998 Effective search space used: 52998 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory