GapMind for catabolism of small carbon sources

 

Alignments for a candidate for glk in Synechococcus elongatus PCC 7942

Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate Synpcc7942_0221 Synpcc7942_0221 glucokinase

Query= curated2:B2J224
         (341 letters)



>FitnessBrowser__SynE:Synpcc7942_0221
          Length = 345

 Score =  347 bits (890), Expect = e-100
 Identities = 188/344 (54%), Positives = 232/344 (67%), Gaps = 6/344 (1%)

Query: 1   MTLLLAGDIGGTKTILQLVETSDSQGLHTIYQESYHSADFPDLVPIVQQFLI---KANTP 57
           MTLLLAGDIGGTKT L L   SD   L  ++Q S+ SA +PDLVP+VQ+FL     A   
Sbjct: 1   MTLLLAGDIGGTKTNLMLAIASDCDRLEPLHQASFASAAYPDLVPMVQEFLAAAPSAEVR 60

Query: 58  IPEKACFAIAGPIVKNTAKLTNLAWFLDTERLQQELGIPHIYLINDFAAVGYGISGLQKQ 117
            P  ACF IAGP+V  TAKLTNL W L   RL +ELGI  + LINDFAA+ YG+ GL  +
Sbjct: 61  SPVVACFGIAGPVVHGTAKLTNLPWQLSEARLAKELGIAQVALINDFAAIAYGLPGLTAE 120

Query: 118 DLHPLQVGKPQPETPIGIIGAGTGLGQGFLIKQGNNYQVFPSEGGHADFAPRNEIEFQLL 177
           D   +QVG+  P  PI I+GAGTGLG+GF+I      QVF SEG HADFAP+ E+E +LL
Sbjct: 121 DQVVVQVGEADPAAPIAILGAGTGLGEGFIIPTAQGRQVFGSEGSHADFAPQTELESELL 180

Query: 178 KYLLDKHDIQRISVERVVSGMGIVAIYQFLRDRKFAAESPDIAQIVRTWEQEAGQEEKSV 237
            +L + + I+ ISVERVVSG GI AIY FLRDR    E+P +  I   W+    Q   + 
Sbjct: 181 HFLRNFYAIEHISVERVVSGQGIAAIYAFLRDRHPDQENPALGAIASAWQTGGDQ---AP 237

Query: 238 DPGAAIGTAALEKRDRLSEQTLQLFIEAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLI 297
           D  AA+  AAL  RD L+ Q +Q+F+ AYGAEAGNLALKLL YGG+Y+AGGIA KILPL+
Sbjct: 238 DLAAAVSQAALSDRDPLALQAMQIFVSAYGAEAGNLALKLLSYGGVYVAGGIAGKILPLL 297

Query: 298 QNSGFLLNFTQKGRMRPLLEEIPVYIILNPQVGLIGAALCAARL 341
            +  FL  F  KGR++ LL  +P+ I+ N +VGLIGA L AA +
Sbjct: 298 TDGTFLQAFQAKGRVKGLLTRMPITIVTNHEVGLIGAGLRAAAI 341


Lambda     K      H
   0.320    0.140    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 349
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 341
Length of database: 345
Length adjustment: 29
Effective length of query: 312
Effective length of database: 316
Effective search space:    98592
Effective search space used:    98592
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate Synpcc7942_0221 Synpcc7942_0221 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))

Software error:

../bin/blast/fastacmd -i /tmp/list.25600.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.25600.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.