Align Amino acid ABC transporter ATP binding protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized)
to candidate Synpcc7942_1414 Synpcc7942_1414 ATPase
Query= TCDB::Q9I405 (244 letters) >FitnessBrowser__SynE:Synpcc7942_1414 Length = 241 Score = 149 bits (377), Expect = 4e-41 Identities = 93/225 (41%), Positives = 130/225 (57%), Gaps = 8/225 (3%) Query: 1 MISIKNVSKWYGD----FQVLTDCSTEVAKGEVVVVCGPSGSGKSTLIKCVNALEPFQKG 56 +I ++VSK YG+ + L +V GE + G SGSGKST + + L+ G Sbjct: 8 VIQFEHVSKIYGEGETTVRALDHVDFQVRAGEYCAIMGASGSGKSTAMNLIGCLDRPTAG 67 Query: 57 DIVVDGTSIADPKTN-LPKLRSR-VGMVFQHFELFPHLSITENLTIAQIKVLGRSKEEAT 114 +DGT +AD + L +R+R +G VFQ F L P LS EN+ + I G S++E Sbjct: 68 RYYLDGTDVADLDDDALAAVRNRKIGFVFQQFHLLPQLSAVENVMLPMIYA-GISQQERR 126 Query: 115 KKGLALLERVGLKEHAHKHPGQLSGGQQQRVAIARALAMDPVVMLFDEPTSALDPEMVNE 174 + +A L +VGL + P QLSGGQQQRVAIARA+ PV++L DEPT ALD + E Sbjct: 127 DRAVAALTQVGLAQRLDNKPNQLSGGQQQRVAIARAIVNQPVLLLADEPTGALDSQTTEE 186 Query: 175 VLDVMVQLAHEGMTMMCVTHEMGFARKVANRVIFMDRGQIVEDCE 219 VL++ QL G+T++ VTHE A + A RVI+ GQI + + Sbjct: 187 VLNIFDQLHQRGITIVIVTHEAEVADR-AERVIWFRDGQIQRETQ 230 Lambda K H 0.320 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 244 Length of database: 241 Length adjustment: 23 Effective length of query: 221 Effective length of database: 218 Effective search space: 48178 Effective search space used: 48178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory