Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate Synpcc7942_0947 Synpcc7942_0947 ATPase
Query= TCDB::G3LHY9 (356 letters) >FitnessBrowser__SynE:Synpcc7942_0947 Length = 355 Score = 196 bits (497), Expect = 1e-54 Identities = 110/346 (31%), Positives = 190/346 (54%), Gaps = 15/346 (4%) Query: 4 ITLDHIRHAYGANPKSDKDYSLKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQPSH 63 + L +R AY + + SL + G LLGPSGCGK+T L +I+GL QP+ Sbjct: 6 LELRQLRKAYSPSVVPVANLSL-----QLQPGEFLTLLGPSGCGKSTTLRLIAGLDQPTS 60 Query: 64 GRILFDGKDVTNLSTQSRNIAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRVRDI 123 G I +++T L R++A VFQ +Y + V NL L+ R + A++++R++ + Sbjct: 61 GSIWLGDREITTLPPGDRDMAMVFQSYALYPHLNVRQNLTLGLQIRRTSAAEIEQRLQQV 120 Query: 124 LEMIDLASWARRKAQGLTADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLRSQL 183 ++L R+ L+ Q+Q+++LGR LVR + L DEPL+ +D ++ +R+Q+ Sbjct: 121 AHNLELDHLLDRRPAQLSGGQRQRVALGRALVRQP-SVFLLDEPLSNLDALLREQVRAQM 179 Query: 184 KRLHKQFGFTMVYVTHDQTEALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYFIGS 243 K L Q +VYVTHDQTEAL+ + ++ ++ G + Q+ +P +++ P++ FV FIGS Sbjct: 180 KALFSQQASPVVYVTHDQTEALSLSHRIAILNGGHLQQLDSPDRIYQAPANAFVAGFIGS 239 Query: 244 PGMNFMPARIEGSTVKVGDETLTLEYAPKTSGTAKTELGIRPEFIRLG----REGMPITI 299 P MN +P I +G L + + ++ G+RPE ++L +P+ + Sbjct: 240 PRMNLLPLPIHSGQAWLGSRALPI--PSHLAARSQVLWGLRPEHLKLATPEVERAIPVQL 297 Query: 300 SKVEDIGRQKIVRARFADQP---IAIVVPEDADIPADARVTFDPSA 342 E++G Q+++ A P + +++P D IP D +VTF+P + Sbjct: 298 HLTENLGMQRLLTVAIAANPEVRLRLLMPSDQPIPTDLQVTFEPES 343 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 355 Length adjustment: 29 Effective length of query: 327 Effective length of database: 326 Effective search space: 106602 Effective search space used: 106602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory