Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate Synpcc7942_0248 Synpcc7942_0248 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine
Query= uniprot:B2TBJ8 (250 letters) >FitnessBrowser__SynE:Synpcc7942_0248 Length = 396 Score = 89.0 bits (219), Expect = 1e-22 Identities = 67/213 (31%), Positives = 113/213 (53%), Gaps = 13/213 (6%) Query: 15 LLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYILVFRGSPLLIQMFLV 74 LL + T L CSL LG LL+L + + WL + YI +FRG PL+ ++ Sbjct: 191 LLLTLATALISMVCSLPLGILLALGRQSSLPAIRWL----SVTYIELFRGLPLVT---IL 243 Query: 75 YYGMGQFGVIRESFLWPVLREPYMCAVLSLALCTAGYTAEIIRGGLMAVPVGQIEAGYSI 134 ++G ++ +S W + R + A++ L + + Y AE +RGGL A+P GQ EA ++ Sbjct: 244 FFGQVMVPLMLDSE-WRIDR--ILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAAL 300 Query: 135 GLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEVTGVAQQIIQQTY-- 192 GL+ F R ++ P ALR +PA + L++ T L S+V + E+ G+++ I+ Sbjct: 301 GLNLFQTYRFIVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYL 360 Query: 193 -RTTEVFICAALIYLFLNFVIVRLLGMLETRLS 224 R EV++ ++Y + + +L LE RL+ Sbjct: 361 GRYAEVYLFLGVLYWLCCYGLAQLSRRLEQRLT 393 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 396 Length adjustment: 27 Effective length of query: 223 Effective length of database: 369 Effective search space: 82287 Effective search space used: 82287 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory