GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aapQ in Synechococcus elongatus PCC 7942

Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 1 (characterized)
to candidate Synpcc7942_0247 Synpcc7942_0247 ABC-type permease for basic amino acids and glutamine

Query= reanno::Smeli:SMc02119
         (397 letters)



>lcl|FitnessBrowser__SynE:Synpcc7942_0247 Synpcc7942_0247 ABC-type
           permease for basic amino acids and glutamine
          Length = 377

 Score =  232 bits (591), Expect = 2e-65
 Identities = 136/384 (35%), Positives = 209/384 (54%), Gaps = 14/384 (3%)

Query: 9   PERSRSSGSIINDPQVRGIFYQAITIIILAALIYWIVDNTVDNLRRANIASGYDFVRSRA 68
           P R +  G    D ++    +Q + ++++     W+VDN V NL +  ++  +D++   A
Sbjct: 2   PFRLKLQGPFWRDERLWRWVWQLLVLLVVGLGAIWLVDNLVYNLSQRGLSLSFDWLDQSA 61

Query: 69  GFDVGQSLISFTSDSTYGRALLVGFINTLLVAITGIITATIIGFIVGIGRLSHNWIIAKL 128
           GF++G+S I++ +  +Y RAL+VG +N+L V   G+I  T+IG + G+   S NW++ +L
Sbjct: 62  GFNIGESAIAYRTADSYARALVVGLVNSLRVIAIGLILTTVIGTLAGVAAFSENWLLRQL 121

Query: 129 SLAYVEVFRNIPPLLVIFFWYSGVLSILPQARDALALPFDIFLSNRGVAFPRPIAEEGAE 188
           S  YV V RN P LL +  WY  +L  LP A+        ++LS +G+  P P       
Sbjct: 122 SRGYVAVVRNTPLLLQLIVWYFPILLSLPAAQQPWHWLGSLYLSKQGIYLPWPQTPGW-- 179

Query: 189 YTLLAFVIAVAASVFFARYARKRQLATGERLPVLWTVLGLIIGLPLVTFLVTGAPITFDI 248
              L  ++A+A  +F +  A++      +R P  W  L   I +  V  L+T       +
Sbjct: 180 ---LVVILAIALVLFVSWLAQR------QRSPRDWRWLYGAIAVVTVLMLLTQLSWPQQL 230

Query: 249 PVAGKFNLTGGSVVGPEFMSLFLALSFYTAAFIAEIVRAGIRGVSKGQTEAAHALGIRPA 308
                  + GG  +  EF +L L L  YT AFI EI+R GI  V  GQ EAA ALG+  +
Sbjct: 231 QPG---QIRGGLRLSLEFTALLLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRS 287

Query: 309 LTTRLVVVPQAMRIIIPPLTSQYLNLTKNSSLAVAIGYADLVAVGGTILNQTGQSIEIVS 368
            T   +VVPQA+R+I+P L SQY+   KNSSLA+A+GY DL A   T LNQTG+ +E+  
Sbjct: 288 QTLWQIVVPQALRVIVPSLNSQYVGFAKNSSLAIAVGYPDLYATAQTTLNQTGRPVEVFL 347

Query: 369 IWLIVYLSLSLATSLFMNWYNARM 392
           I ++ YL+++   S  MN    R+
Sbjct: 348 ILMLTYLAINAVISAGMNGLQQRL 371


Lambda     K      H
   0.327    0.141    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 416
Number of extensions: 15
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 397
Length of database: 377
Length adjustment: 30
Effective length of query: 367
Effective length of database: 347
Effective search space:   127349
Effective search space used:   127349
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory