Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate Synpcc7942_1414 Synpcc7942_1414 ATPase
Query= TCDB::P73721 (252 letters) >FitnessBrowser__SynE:Synpcc7942_1414 Length = 241 Score = 152 bits (383), Expect = 8e-42 Identities = 91/232 (39%), Positives = 137/232 (59%), Gaps = 9/232 (3%) Query: 1 MTSPTAPLISFDQLQKNFG----ALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNR 56 M P+I F+ + K +G ++ L V ++ + +I+G SG GKST + + Sbjct: 1 MAESAPPVIQFEHVSKIYGEGETTVRALDHVDFQVRAGEYCAIMGASGSGKSTAMNLIGC 60 Query: 57 LEPISGGRLEVAGVDLSGAKIDQKHLRQLRVR-VGMVFQHFNLFPHLTVLQNLLLAPRKV 115 L+ + GR + G D+ A +D L +R R +G VFQ F+L P L+ ++N++L P Sbjct: 61 LDRPTAGRYYLDGTDV--ADLDDDALAAVRNRKIGFVFQQFHLLPQLSAVENVML-PMIY 117 Query: 116 LRIPMAEAKDRALTYLDKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTS 175 I E +DRA+ L +VGL + DN P+QLSGGQ+QRVAIAR + +P +LL DEPT Sbjct: 118 AGISQQERRDRAVAALTQVGLAQRLDNKPNQLSGGQQQRVAIARAIVNQPVLLLADEPTG 177 Query: 176 ALDPELVGEVLNVMKQLAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEE 227 ALD + EVLN+ QL + G+T+ +VTHE + A + + RV +F G I+ E Sbjct: 178 ALDSQTTEEVLNIFDQLHQRGITIVIVTHEAEVA-DRAERVIWFRDGQIQRE 228 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 241 Length adjustment: 24 Effective length of query: 228 Effective length of database: 217 Effective search space: 49476 Effective search space used: 49476 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory