Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate Synpcc7942_0513 Synpcc7942_0513 ATPase
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__SynE:Synpcc7942_0513 Length = 250 Score = 111 bits (277), Expect = 2e-29 Identities = 81/263 (30%), Positives = 137/263 (52%), Gaps = 34/263 (12%) Query: 15 LKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITFN 74 +++E++ +G + +N S +G++ L+GPNGAGKTT F TG +P G + + Sbjct: 11 IRLENVRKSYGKRLIVNRVSLSVAQGEVVGLLGPNGAGKTTTFYMTTGLERPDEGHVWLD 70 Query: 75 QKSGKQYLLERLPDFRITKEARVARTF--QNIRLFSGLTVLENLLVAQHNKLMKASGYTI 132 + L RLP +T+ AR+ + Q +F LTV+ENLL+ + Sbjct: 71 ETE-----LTRLP---MTQRARLGIGYLAQEASIFRHLTVVENLLL-------------V 109 Query: 133 LGLIGV-GPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCT--- 188 L G+ G +R+ E + L+ F LEK A + G +RR EIARA+ Sbjct: 110 LQQTGIRGREQRQRVEEL-LSEFRLEKV-----AHTQGIRVSGGERRRTEIARALAVGSQ 163 Query: 189 GPELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYG 248 GP+ L LDEP AG++P A + ++ +RA+ IL+ +H++ ++I+D +L G Sbjct: 164 GPKFLLLDEPFAGIDPIAVAEVQEIIARLRAQQ-MGILITDHNVRETLKITDRAYILRDG 222 Query: 249 QKISDGTPDHVKNDPRVIAAYLG 271 + ++ G+ + + ++P V YLG Sbjct: 223 EILAAGSAEELASNPLVRQYYLG 245 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 250 Length adjustment: 25 Effective length of query: 267 Effective length of database: 225 Effective search space: 60075 Effective search space used: 60075 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory