Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate Synpcc7942_2492 Synpcc7942_2492 ATPase
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__SynE:Synpcc7942_2492 Length = 237 Score = 199 bits (507), Expect = 3e-56 Identities = 111/235 (47%), Positives = 153/235 (65%), Gaps = 2/235 (0%) Query: 9 QPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSV 68 +PLLQ++ + YG + AL + + + GEIV+LIGANGAGKST + I + G + Sbjct: 3 EPLLQLSQIAVNYGAVVALTDLTLEIFPGEIVALIGANGAGKSTTLRAISRLVPLQQGRI 62 Query: 69 VFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLK-HFAEDVEKIF 127 ++ +D+ +P ++ +A PEGRR+ R +V NL++GA + D+E F Sbjct: 63 YYDQQDLGLIPAPQLVGRGLAHCPEGRRVLARQSVRINLELGAYCRRDRIGIQTDLELQF 122 Query: 128 TLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIR 187 FPRL+ER Q GTLSGGEQQML+I RALM+RP+LLLLDEPSLGLAP IV+ IF IR Sbjct: 123 DRFPRLRERQNQPAGTLSGGEQQMLAIARALMSRPRLLLLDEPSLGLAPQIVQEIFSVIR 182 Query: 188 KLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 L E +G+T+ LVEQNA AL+ + R YV+ G++ SG +LL +P V+ AYL Sbjct: 183 SLRE-QGMTILLVEQNATLALQTADRGYVLEAGQLLFSGPAADLLIDPRVKQAYL 236 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 237 Length adjustment: 23 Effective length of query: 224 Effective length of database: 214 Effective search space: 47936 Effective search space used: 47936 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory