Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate Synpcc7942_2177 Synpcc7942_2177 integral membrane protein of the ABC-type Nat permease for neutral amino acids NatD
Query= TCDB::P74318 (286 letters) >FitnessBrowser__SynE:Synpcc7942_2177 Length = 296 Score = 333 bits (853), Expect = 4e-96 Identities = 158/280 (56%), Positives = 211/280 (75%) Query: 3 LSQLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWWANTSGINLWLS 62 L+QL NG+A GS++AL A GLTL YGILRL+NFA G+F+TL AY T AN+ G++LWL+ Sbjct: 15 LAQLAINGLATGSLLALAATGLTLIYGILRLTNFAQGEFLTLGAYFTLVANSLGLSLWLA 74 Query: 63 MALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLIWGGNNQNYR 122 + LG + TI +GE +LW+P+R +R TTLII++IGL+LFLRN ++LIWG NQ YR Sbjct: 75 IPLGAIATIALCLLGEAVLWEPLRRQRVNTTTLIILTIGLSLFLRNLVILIWGAGNQAYR 134 Query: 123 VPIVPAQDFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVADNVDLAKVSGI 182 + + PA G++ LLV+ A AA+V+LH +LQRT +GK MRA+AD+ DLA+VSG+ Sbjct: 135 LAVQPALTLWGLRITLNSLLVVIGAAAALVLLHWVLQRTSIGKGMRAIADDPDLARVSGV 194 Query: 183 NVEWVVMWTWVMTAVLTALGGSMYGLMTTLKPNMGWFLILPMFASVILGGIGNPYGAIAG 242 VE V+ WTWV+ LTA+ G +YGL+T ++P MGW LILP+FAS ILGGIG+PYGAIAG Sbjct: 195 PVETVIRWTWVIAGGLTAIAGGLYGLITAVRPTMGWNLILPLFASAILGGIGSPYGAIAG 254 Query: 243 GIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFIRPQGLF 282 G+I+G AQE+S W YK+ VA +++I +L IRPQGLF Sbjct: 255 GLILGFAQELSTYWLPAEYKLAVAFVILIGVLVIRPQGLF 294 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 296 Length adjustment: 26 Effective length of query: 260 Effective length of database: 270 Effective search space: 70200 Effective search space used: 70200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory