Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate Synpcc7942_0513 Synpcc7942_0513 ATPase
Query= TCDB::P73650 (240 letters) >FitnessBrowser__SynE:Synpcc7942_0513 Length = 250 Score = 117 bits (292), Expect = 3e-31 Identities = 73/221 (33%), Positives = 116/221 (52%), Gaps = 5/221 (2%) Query: 20 ILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEIIFKGENITGLGSDQIVR 79 I+ ++ S+A GE+V ++GPNGAGK+T GL P +G + +T L Q R Sbjct: 25 IVNRVSLSVAQGEVVGLLGPNGAGKTTTFYMTTGLERPDEGHVWLDETELTRLPMTQRAR 84 Query: 80 RGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDRIYTMFP--KLAQRRNQRAGTL 137 G+ Y+ Q ++F LTV ENL + + + R+ + +L + + + + Sbjct: 85 LGIGYLAQEASIFRHLTVVENLLLVLQQTGIRGREQRQRVEELLSEFRLEKVAHTQGIRV 144 Query: 138 SGGERQMLAMGRALMLD---PDLLLLDEPSAALSPILVKDVFAQIKAINATGKAIILVEQ 194 SGGER+ + RAL + P LLLDEP A + PI V +V I + A I++ + Sbjct: 145 SGGERRRTEIARALAVGSQGPKFLLLDEPFAGIDPIAVAEVQEIIARLRAQQMGILITDH 204 Query: 195 NAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYLG 235 N ++ L + DR Y+L +G GS + L ++PLV + YLG Sbjct: 205 NVRETLKITDRAYILRDGEILAAGSAEELASNPLVRQYYLG 245 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 250 Length adjustment: 24 Effective length of query: 216 Effective length of database: 226 Effective search space: 48816 Effective search space used: 48816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory