GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dgoD in Synechococcus elongatus PCC 7942

Align L-arabinonate dehydratase; ArDHT; D-fuconate dehydratase; Galactonate dehydratase; L-arabonate dehydratase; EC 4.2.1.25; EC 4.2.1.67; EC 4.2.1.6 (characterized)
to candidate Synpcc7942_0626 Synpcc7942_0626 dihydroxy-acid dehydratase

Query= SwissProt::B5ZZ34
         (579 letters)



>lcl|FitnessBrowser__SynE:Synpcc7942_0626 Synpcc7942_0626
           dihydroxy-acid dehydratase
          Length = 619

 Score =  258 bits (659), Expect = 5e-73
 Identities = 186/554 (33%), Positives = 280/554 (50%), Gaps = 66/554 (11%)

Query: 44  RPVIGILNTWSDMTPCNGHLRELAEKVKAGVWEAGGFPLEVPVFSASEN-TFRPTAMMY- 101
           +P+I + N+++   P + HL++L + V   +  AGG   E    +  +        M+Y 
Sbjct: 34  KPIIAVANSFTQFVPGHVHLKDLGQLVAREIERAGGVAKEFNTIAVDDGIAMGHGGMLYS 93

Query: 102 ---RNLAALAVEEAIRGQPMDGCVLLVGCDKTTPSLLMGAASCDLPSIVVTGGPMLNGYF 158
              R+L A +VE  +     D  V +  CDK TP +LM A   ++P++ V+GGPM  G  
Sbjct: 94  LPSRDLIADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPAVFVSGGPMEAG-- 151

Query: 159 RGERVGSGTHLWKFSEMVKAGEMTQAEFLEAEASMSRSS----GTCNTMGTASTMASMAE 214
           +    G   HL     MV A +  +++  E  A++ RS+    G+C+ M TA++M  + E
Sbjct: 152 KVILNGEERHLDLVDAMVVAADDRESD--EDVATIERSACPTCGSCSGMFTANSMNCLTE 209

Query: 215 ALGMALSGNAAIPGVDSRRKVMAQLTGRRIVQMVK-------DDLKPSEIMTKQAFENAI 267
           ALG++L GN ++      RK +    GR  V++ K       + + P  I + +AFENAI
Sbjct: 210 ALGLSLPGNGSLLATHGDRKELFLEAGRLAVKLAKQYYEQDDESVLPRSIASFKAFENAI 269

Query: 268 RTNAAIGGSTNAVIHLLAIAGRVGIDLSLDDWDRCGRDVPTIVNLMPS-GKYLMEEFFYA 326
             + A+GGSTN V+HLLA A   G+D ++ D DR  R +P +  + PS  KY ME+   A
Sbjct: 270 CLDIAMGGSTNTVLHLLAAAHEAGVDFTMKDIDRLSRKIPNLCKVAPSTQKYHMEDVHRA 329

Query: 327 GGLPVVLKRLGEAGLLHKDALTV--------------SGETVWDEVKD------------ 360
           GG+  +L  L  AGLLH++  TV              + ET  +E K             
Sbjct: 330 GGVIAILGELDRAGLLHREVPTVHSPSLGAALDQWDINRETATEEAKSRYLAAPGGVPTQ 389

Query: 361 ------------VVNWNEDVILPAEKALTSSGGIVVLRGNLAPKGAVLKPSAASPHLLVH 408
                        ++     I   E A +  GG+ VL GNLA +G ++K +    ++LV 
Sbjct: 390 EAFSQSKRWTALDLDRENGCIRDIEHAYSQDGGLAVLYGNLAEQGCIVKTAGVDENILVF 449

Query: 409 KGRAVVFEDIDDYKAKINDDNLDIDENCIMVMKNCGPKGYPGMAEVGNMGLPPKVLK-KG 467
            G AVV E  D+    I   N  + E  +++++  GP+G PGM E   M  P   LK KG
Sbjct: 450 SGPAVVCESQDEAVNWIL--NGRVKEGDVVLIRYEGPRGGPGMQE---MLYPTSYLKSKG 504

Query: 468 I-LDMVRISDARMSGTAYGTVVLHTSPEAAVGGPLAVVKNGDMIELDVPNRRLHLDISDE 526
           +      I+D R SG   G  + H SPEAA GG +A+V+ GD IE+D+PNRR+HL +S+E
Sbjct: 505 LGKACALITDGRFSGGTSGLSIGHVSPEAAEGGLIALVEQGDRIEIDIPNRRIHLAVSEE 564

Query: 527 ELARRLAEWQPNHD 540
           ELA R A  +   D
Sbjct: 565 ELAHRRAAMEARGD 578


Lambda     K      H
   0.318    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 957
Number of extensions: 52
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 579
Length of database: 619
Length adjustment: 37
Effective length of query: 542
Effective length of database: 582
Effective search space:   315444
Effective search space used:   315444
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory