Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate Synpcc7942_2100 Synpcc7942_2100 dTDP-glucose 4,6-dehydratase
Query= BRENDA::F2NQX6 (314 letters) >FitnessBrowser__SynE:Synpcc7942_2100 Length = 357 Score = 140 bits (352), Expect = 6e-38 Identities = 102/335 (30%), Positives = 161/335 (48%), Gaps = 36/335 (10%) Query: 1 MRVLVTGGAGFIGSHLVHALHQKGIPVAVLD--------DLSTGKRAHIPPDVPLYQTDI 52 M++L+TGGAGFIGS L+ L + +++ DL++ + Q D+ Sbjct: 1 MKILITGGAGFIGSALIRHLLTTRLDARIINLDKLSYASDLTSLQPFEDSDRYVFEQVDL 60 Query: 53 RDLNAVLHAFQDFQPTHVAHQAAQASVKHSVQNPCKDAEINLLGGLNILEAMR------- 105 D A+ FQ +QPT V H AA++ V S+ +P E N+LG N+LEA R Sbjct: 61 LDEAALTRIFQTYQPTAVMHLAAESHVDRSIDSPRPFIESNILGTFNLLEAARRYWQELS 120 Query: 106 --ATGTQKIVFASTGGAIYGEVPEGRRAPETWPPKPKSPYAASKAAFEHYLEVYRQTHGL 163 T + ST +YG + E E P+SPY+ASKA+ +H + + T+GL Sbjct: 121 ESEQQTFRFHHIST-DEVYGSLGETGLFTEATRYDPRSPYSASKASSDHLVRAWHHTYGL 179 Query: 164 TYTTLRYANVYGPRQDPHGEAGVVAIFTNRLLHAQPVTLYARKEPGDPGCIRDYIHVEDV 223 +N YGP Q P ++ + + P+ +Y G+ G IRD+++VED Sbjct: 180 PVLVTNCSNNYGPWQFPE---KLIPVIILNAIAGNPLPIY-----GNGGNIRDWLYVEDH 231 Query: 224 TRA-NLLALETNLEGTYNVSTGQGRTTEDVLYTIA--------RALGTTPRVTYAPPRDG 274 TRA + L+ + TYN+ RT V+ TI R+ ++ + R G Sbjct: 232 TRALEQVLLKGQIGETYNIGGFNERTNLQVVETICDLLDELKPRSQSYRQQMEFVRDRPG 291 Query: 275 DLEVSVLDPTQLQAH-GWRPQVPFEEGIRRTVAWF 308 +D ++++ GW+PQ FE G+R+TV W+ Sbjct: 292 HDRRYAIDASRIERELGWQPQESFETGLRKTVCWY 326 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 357 Length adjustment: 28 Effective length of query: 286 Effective length of database: 329 Effective search space: 94094 Effective search space used: 94094 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory