Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate Synpcc7942_1261 Synpcc7942_1261 triosephosphate isomerase
Query= SwissProt::P00943 (253 letters) >lcl|FitnessBrowser__SynE:Synpcc7942_1261 Synpcc7942_1261 triosephosphate isomerase Length = 263 Score = 240 bits (612), Expect = 2e-68 Identities = 127/248 (51%), Positives = 173/248 (69%), Gaps = 11/248 (4%) Query: 1 MRKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVV-CAPFLFLDRLVQAADGTDL 59 +R+ IIAGNWKM+KT AEA++F++ + E VV CAPF L L + G+ + Sbjct: 22 VRRIIIAGNWKMYKTQAEALEFLQAFLPQLSETPESRKVVLCAPFTTLSSLSKTLHGSRV 81 Query: 60 KIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTR 119 ++GAQ +H+A +GA+TGE+S ML ++GV YV++GHSERRQ F ETDETVN+++LAA + Sbjct: 82 RVGAQNIHWAKEGAFTGEISGAMLTEIGVRYVVVGHSERRQYFGETDETVNQRLLAAQSF 141 Query: 120 GLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSST 179 GL+PI+C GES ++R+AG+T AV++ Q+E+ L G + VIAYEPIWAIGTG + Sbjct: 142 GLLPILCVGESKQQRDAGETEAVISRQLERGLVGADQTNL---VIAYEPIWAIGTGDTCA 198 Query: 180 PEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLE 239 E+AN V G IRS + P IQYGGSVKP+NI + +AQ +IDG LVGGASLE Sbjct: 199 AEEANRVIGLIRSQLKDTDVP-------IQYGGSVKPENIDEIMAQPEIDGALVGGASLE 251 Query: 240 PASFLQLV 247 SF ++V Sbjct: 252 AESFARIV 259 Lambda K H 0.318 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 263 Length adjustment: 24 Effective length of query: 229 Effective length of database: 239 Effective search space: 54731 Effective search space used: 54731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate Synpcc7942_1261 Synpcc7942_1261 (triosephosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.4674.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-54 169.4 0.0 6.6e-54 169.1 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_1261 Synpcc7942_1261 triosephosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_1261 Synpcc7942_1261 triosephosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 169.1 0.0 6.6e-54 6.6e-54 1 228 [] 26 253 .. 26 253 .. 0.92 Alignments for each domain: == domain 1 score: 169.1 bits; conditional E-value: 6.6e-54 TIGR00419 1 lviinfKlnesvgkvelevaklaeevase.agvevavappfvdldvvkdeve.seiqvaAqnvdavksG 67 ++ +n+K+ + + + ++ +++++ + +v++ pf l+ +++ ++ s+++v+Aqn++ k G lcl|FitnessBrowser__SynE:Synpcc7942_1261 26 IIAGNWKMYKTQAEALEFLQAFLPQLSETpESRKVVLCAPFTTLSSLSKTLHgSRVRVGAQNIHWAKEG 94 6899***888999999999999999998626789******************9**************** PP TIGR00419 68 aftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartin 136 aftGeis +ml ++G+++v++gHsErR ++ e+de +++++ ++ gl +++Cvge++++r+a++t lcl|FitnessBrowser__SynE:Synpcc7942_1261 95 AFTGEISGAMLTEIGVRYVVVGHSERRQYFGETDETVNQRLLAAQSFGLLPILCVGESKQQRDAGETEA 163 *****************************************************************9988 PP TIGR00419 137 nvattaaaaA....lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasv 201 ++ ++ + ++ v+A+EP+++iGtG + + ea+ v + +r lk +v ++yG+sv lcl|FitnessBrowser__SynE:Synpcc7942_1261 164 VISRQLERGLvgadQTNLVIAYEPIWAIGTGDTCAAEEANRVIGLIRSQLK------DTDVPIQYGGSV 226 888775432222358999*****************************4444......5799******** PP TIGR00419 202 taaedaelaaqldvdGvLlasavlkae 228 + ++ e +aq+++dG+L+++a+l ae lcl|FitnessBrowser__SynE:Synpcc7942_1261 227 KPENIDEIMAQPEIDGALVGGASLEAE 253 ************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (263 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 5.96 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory