Align 2-oxoisovalerate dehydrogenase subunit alpha; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDH E1-alpha; EC 1.2.4.4 (characterized)
to candidate Synpcc7942_1944 Synpcc7942_1944 Pyruvate dehydrogenase (lipoamide)
Query= SwissProt::Q5SLR4 (367 letters) >FitnessBrowser__SynE:Synpcc7942_1944 Length = 342 Score = 176 bits (446), Expect = 8e-49 Identities = 111/320 (34%), Positives = 163/320 (50%), Gaps = 10/320 (3%) Query: 40 RLYRDMLAARMLDERYTILIRTGKT-SFIAPAAGHEAAQVAIAHAIRPGFDWVFPYYRDH 98 R+Y DM+ R +++ + GK F+ G EA I A+R D+V YRDH Sbjct: 24 RIYEDMVLGRTFEDKCAEMYYRGKMFGFVHLYNGQEAVASGIIKAMRSD-DYVCSTYRDH 82 Query: 99 GLALALGIPLKELLGQMLATKADPNKGRQMPEHPGSKALNFFTVASPIASHVPPAAGAAI 158 AL+ G+P ++++ ++ + ++GR H S N + +A +P A GAA Sbjct: 83 VHALSAGVPARQVMAELFGKETGCSRGRGGSMHLFSAEHNLLGGFAFVAEGIPVATGAAF 142 Query: 159 SMKLLRTG-------QVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNFYAISVD 211 + R QV C FGDGA + G ++ +N A + P +F+ ENN +AI + Sbjct: 143 TTAYRRNALGDTSADQVTACFFGDGAANNGQFFECLNMATLWKLPILFVVENNKWAIGMS 202 Query: 212 YRHQTHSPTIADKAHAFGIPGYLVDGMDVLASYYVVKEAVERARRGEGPSLVELRVYRYG 271 + T P I K AFG+PG VDGMDVLA V +EA+ RAR GEGP+L+E YR+ Sbjct: 203 HERATSDPEIYKKGPAFGMPGVEVDGMDVLAVRAVAQEAIARARAGEGPTLIEALTYRFR 262 Query: 272 PHSSADDDSRYRPKEEVAFWRKKDPIPRFRRFLEARGLWNEEWEEDVREEIRAELERGLK 331 HS AD D R KEE FW +DPI RF L L E + + ++I A + ++ Sbjct: 263 GHSLADPD-ELRSKEEKEFWLARDPIKRFAAHLTEFNLATHEELKAIDKKIEALVAEAVE 321 Query: 332 EAEEAGPVPPEWMFEDVFAE 351 A + PE + ++AE Sbjct: 322 FAISSPEPKPEELTRYIWAE 341 Lambda K H 0.320 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 350 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 342 Length adjustment: 29 Effective length of query: 338 Effective length of database: 313 Effective search space: 105794 Effective search space used: 105794 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory