Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate Synpcc7942_1406 Synpcc7942_1406 ATPase
Query= TCDB::Q8DQH8 (254 letters) >FitnessBrowser__SynE:Synpcc7942_1406 Length = 368 Score = 118 bits (295), Expect = 2e-31 Identities = 76/240 (31%), Positives = 120/240 (50%), Gaps = 22/240 (9%) Query: 3 LLEVKQLTKHFGG--LTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTV 60 +L + ++ K F G L AV V+ EL GE++GL+GP+G GKTTL ++ G G++ Sbjct: 6 VLCLDRVCKQFSGSSLAAVDQVSFELEAGEILGLVGPSGCGKTTLLRMIAGFESLQSGSI 65 Query: 61 TLDGHLL-NGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLP 119 L G + + + +G FQ+ LF LTVLDNV FG Sbjct: 66 QLAGETVATAQRSLPPETRSVGMVFQDYALFPHLTVLDNV--CFG--------------- 108 Query: 120 AFYKSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPA 179 + K A A + L + L+G LS GQQ+R+ + RALA +P ++ LDEP Sbjct: 109 --LRDRKGSAAVARQALALVGLEGLERRYPHELSGGQQQRVALARALAPQPPLILLDEPL 166 Query: 180 AGMNPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEI 239 + ++ Q L + +R I + + T +L+ HD + + +R+ V+ GR G P+E+ Sbjct: 167 SNLDVQVRLRLRQELRDILRQAQATAILVTHDQEEALSICDRVAVMRLGRFEQIGQPEEL 226 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 368 Length adjustment: 27 Effective length of query: 227 Effective length of database: 341 Effective search space: 77407 Effective search space used: 77407 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory