Align 5-aminopentanamidase (EC 3.5.1.30) (characterized)
to candidate Synpcc7942_2358 Synpcc7942_2358 nitrilase-like
Query= BRENDA::B3IVI7 (264 letters) >FitnessBrowser__SynE:Synpcc7942_2358 Length = 276 Score = 90.9 bits (224), Expect = 3e-23 Identities = 76/252 (30%), Positives = 122/252 (48%), Gaps = 16/252 (6%) Query: 14 DVPGNLQRLRHQAQLAAERGAQLLVCPEMFLTGYNIGLAQVERLAEAADGPAAMTVVEIA 73 D+ NL + LA RGA+L+ PE F + +V++ E A+ + +A Sbjct: 16 DLEKNLTQAEEWIDLAVRRGAELVGLPENF-SFLGEEAQKVQQAPEIAERTEKF-LKTMA 73 Query: 74 QAHRIAIVYG-YPERGDDGAIYNSVQLIDAHGRSLSNYRKTHLFGE--------LDRSMF 124 Q ++I ++ G +P + + N++ L+ G++L+ Y K HLF + + Sbjct: 74 QRYQITLLGGGFPVPAEHNHVTNTLLLVGPDGQTLAQYNKVHLFDVDLPDGNTYQESATV 133 Query: 125 SPGADHFPVVELEGW-KVGLLICYDIEFPENARRLALDGAELILVPTA--NMTPYDFTCQ 181 G ++ PV + E + ++G ICYD+ FPE R LA AE+I VP A T D Q Sbjct: 134 LAGREYPPVYDSERFGRLGFSICYDVRFPELYRHLANQSAEVIFVPAAFTAFTGKDH-WQ 192 Query: 182 VTVRARAQENQCYLVYANYCGAE-DEIEYCGQSSIIGPDGSLLAMAGRDECQLLAELEHE 240 V ++ARA EN Y++ G + G + I+ P G +LA AGR+ +AE+ Sbjct: 193 VLLQARAIENTAYIIAPAQTGVHYGRRQTHGHAMIVDPWGIVLANAGREPGLAIAEISPR 252 Query: 241 RVVQGRTAFPYL 252 R+ R P L Sbjct: 253 RLATVRQQMPCL 264 Lambda K H 0.322 0.139 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 276 Length adjustment: 25 Effective length of query: 239 Effective length of database: 251 Effective search space: 59989 Effective search space used: 59989 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory