Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate Synpcc7942_1406 Synpcc7942_1406 ATPase
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__SynE:Synpcc7942_1406 Length = 368 Score = 140 bits (353), Expect = 4e-38 Identities = 87/224 (38%), Positives = 122/224 (54%), Gaps = 14/224 (6%) Query: 39 IDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQVDGIDLAATTREAAQVRSDI 98 + ++ GE + L GPSG GK+TL+R I E Q GSIQ+ G +A R + Sbjct: 27 VSFELEAGEILGLVGPSGCGKTTLLRMIAGFESLQSGSIQLAGETVATAQRSLPPETRSV 86 Query: 99 GMVFQHFNLFPHMSVLDNCLLAPTSVRGL-SRKDAEERARMYLSKVGIESQAHKYPSQLS 157 GMVFQ + LFPH++VLDN GL RK + AR L+ VG+E +YP +LS Sbjct: 87 GMVFQDYALFPHLTVLDNVCF------GLRDRKGSAAVARQALALVGLEGLERRYPHELS 140 Query: 158 GGQQQRVAIARALCMKPRIMLFDEPTSALDPE----MVAEVLDVLVQLAGTGMTMLCVTH 213 GGQQQRVA+ARAL +P ++L DEP S LD + + E+ D+L Q T + VTH Sbjct: 141 GGQQQRVALARALAPQPPLILLDEPLSNLDVQVRLRLRQELRDILRQAQATA---ILVTH 197 Query: 214 EMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRTERAKAFLAQ 257 + A + +RV + G+ + P+ F P + FL+Q Sbjct: 198 DQEEALSICDRVAVMRLGRFEQIGQPEELFQHPASRFVAEFLSQ 241 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 368 Length adjustment: 27 Effective length of query: 233 Effective length of database: 341 Effective search space: 79453 Effective search space used: 79453 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory