Align ABC transporter for D-Maltose and D-Trehalose, permease component 2 (characterized)
to candidate Synpcc7942_0471 Synpcc7942_0471 ABC-type sugar transport system permease component-like
Query= reanno::Smeli:SMc03063 (380 letters) >FitnessBrowser__SynE:Synpcc7942_0471 Length = 276 Score = 134 bits (338), Expect = 2e-36 Identities = 84/253 (33%), Positives = 138/253 (54%), Gaps = 20/253 (7%) Query: 134 SRGQRIFFTATTPPRF-----TLDNYAEVLSAAGIGRSFLNSLTVAVPSTVIPILIAAFA 188 S G+ IF PP+F TLDN+ V + +G+ FLNS VA+ + + +L + A Sbjct: 37 SAGEDIF---QFPPQFLPTQPTLDNFRRVWTENPLGQYFLNSTWVALLTVGLNLLFCSLA 93 Query: 189 AYALAWMPFPGRAVLLAVVVGLLVVPLQMSLIPLLQLYNGVGAFFGVSAKTYMGIWLAH- 247 AY LA + F GR L ++V +++P Q+ +IPL L +G TY+G+ + Sbjct: 94 AYPLARLEFKGRQTLFLLIVATILIPFQVVMIPLYVLIINLGL-----RNTYLGLVFPYL 148 Query: 248 -TGFGLPLAIYLLRNYMAGLPREIMESARVDGASDFDIFVKIILPLSFPALASFAIFQFL 306 + FG I+LLR G+P+++ E+AR+DG +D ++ +++P + PAL + AIF F+ Sbjct: 149 ASAFG----IFLLRQAFQGIPKDLEEAARIDGCNDLGVWWNVMIPSARPALITLAIFVFI 204 Query: 307 WTWNDLLVAIVFLGAGDDKLVLTGRLVNLLGSRGGNWEILTASAFITIVVPLIVFFALQR 366 +W+D L ++ L D+ L + L +W ++ A + ++I+ VF ALQR Sbjct: 205 GSWSDFLWPLIILDE-PDRYTLPLGIATLASGFSLDWRLVAAGSVLSILPVFGVFLALQR 263 Query: 367 YLVRGLLAGSVKG 379 Y+V A VKG Sbjct: 264 YIVPSAAASGVKG 276 Lambda K H 0.324 0.139 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 380 Length of database: 276 Length adjustment: 28 Effective length of query: 352 Effective length of database: 248 Effective search space: 87296 Effective search space used: 87296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory