Align ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized)
to candidate Synpcc7942_1237 Synpcc7942_1237 nitrate transport ATP-binding subunits C and D
Query= BRENDA::P68187 (371 letters) >FitnessBrowser__SynE:Synpcc7942_1237 Length = 659 Score = 142 bits (357), Expect = 3e-38 Identities = 93/305 (30%), Positives = 162/305 (53%), Gaps = 14/305 (4%) Query: 14 GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPA 73 G+ + KD++L+I GEF+ +G SGCGKSTLL +IAGL +SG + + +++ + P Sbjct: 20 GQYIALKDVSLNIRPGEFISLIGHSGCGKSTLLNLIAGLAQPSSGGIILEGRQVTEPGPD 79 Query: 74 ERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQR--VNQVAEVLQLAHLLDRKP 131 +VFQ+Y+L P +V +N++ + + +R + + +++ L D+ P Sbjct: 80 RM---VVFQNYSLLPWRTVRQNIALAVDSVLHDRNRTERRTIIEETIDLVGLRAAADKYP 136 Query: 132 KALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVT 191 +SGG +QRVAI R L P + LLDEP LDA R ++ ++ R+ + G T + VT Sbjct: 137 HEISGGMKQRVAIARGLAIRPKLLLLDEPFGALDALTRGNLQEQLMRICQEAGVTAVMVT 196 Query: 192 HDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAI 251 HD EA+ L+D++V+L G AQ+G+ LE+ +P R + +P L ++ I Sbjct: 197 HDVDEALLLSDRVVMLTNGPAAQIGQILEV-DFPRPRQRLEMMETPHYYDLRNEL----I 251 Query: 252 DQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLG 311 + +Q + R + P + V A+ +R L +D A + + E+ + + LG Sbjct: 252 NFLQQQRRAKRRAKAAAPAPA----VAASQQKTVRLGFLPGNDCAPLAIAQELGLFQDLG 307 Query: 312 NETQI 316 ++ Sbjct: 308 LSVEL 312 Lambda K H 0.320 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 481 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 659 Length adjustment: 34 Effective length of query: 337 Effective length of database: 625 Effective search space: 210625 Effective search space used: 210625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory