Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate Synpcc7942_0960 Synpcc7942_0960 ATPase
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__SynE:Synpcc7942_0960 Length = 417 Score = 299 bits (766), Expect = 8e-86 Identities = 183/402 (45%), Positives = 238/402 (59%), Gaps = 43/402 (10%) Query: 1 MARVLLEHIYKTYPGQTEPTVKD-------FNLDIQDKEFTVFVGPSGCGKTTTLRMIAG 53 +A V+ E I K +P Q K NL+I D EF V VGPSGCGK+T LR++AG Sbjct: 23 VAGVVFEEIEKRFPEQARSPQKGEVVVLNGINLEIADGEFMVVVGPSGCGKSTLLRLLAG 82 Query: 54 LEDITEGNLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLK---------- 103 LE + G + +GDRRV+ +P K RDIAMVFQ+YALYPH++VY N+AFGL+ Sbjct: 83 LETPSRGLIKVGDRRVDRLPAKARDIAMVFQSYALYPHLSVYDNLAFGLRRQGDRPWWQQ 142 Query: 104 -----LRKVPK---------AEIDRRVQEAAKILDIAHLLDRKPKALSGGQRQRVALGRA 149 R +PK A I RRV+E A +L + LLDR+PK LSGGQ+QRVALGRA Sbjct: 143 QLALATRSLPKSLQYEPEQEARIKRRVREVATMLQLDTLLDRQPKQLSGGQKQRVALGRA 202 Query: 150 IVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQRLQTTVIYVTHDQTEAMTMGDRIVVM 209 I R PQVFLMDEPLSNLDAKLR + RA+I L ++L T +YVTHDQTEAMTMGDRI V+ Sbjct: 203 IARNPQVFLMDEPLSNLDAKLRAETRAQIVSLQRQLGVTTLYVTHDQTEAMTMGDRIAVL 262 Query: 210 RDGVIQQADTPQVVYSQPKNMFVAGFIGSPAMNFIRGEIVQDGDAFYFRAPSISLRLPEG 269 G +QQ +P +Y +P N FVA FIGSP MN I V + LPE Sbjct: 263 NRGHLQQVASPLEIYDRPANRFVAQFIGSPPMNLIP---VTVRAPLQLTTENFRCTLPEA 319 Query: 270 RYGVLKASGAIGKPVVLGVRPEDLHDEEVFMTTYPDSVLQMQVEVVEHMGSEVYLHTSIG 329 VL+ G+ V LG+RPE L + L + V VE +GS+ ++ + Sbjct: 320 WEPVLRLYD--GQTVELGIRPEHLE-----VGAAASKNLLITVTGVEALGSDTFIAGELK 372 Query: 330 PNTIV--ARVNPRHVYHVGSSVKLAIDLNKIHIFDAETEESI 369 + I AR+ P+ + +G + L ++IH+FD ET ++I Sbjct: 373 ESGIAVQARLAPQQCWQMGDRLWLTFKPDQIHLFDLETGKAI 414 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 417 Length adjustment: 31 Effective length of query: 353 Effective length of database: 386 Effective search space: 136258 Effective search space used: 136258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory