Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate Synpcc7942_0947 Synpcc7942_0947 ATPase
Query= BRENDA::Q8NMV1 (376 letters) >FitnessBrowser__SynE:Synpcc7942_0947 Length = 355 Score = 279 bits (713), Expect = 1e-79 Identities = 162/357 (45%), Positives = 217/357 (60%), Gaps = 25/357 (7%) Query: 21 VKKFNLEIADGEFLVLVGPSGCGKSTTLRMLAGLENVTDGAIFIGDKDVTHVAPRDRDIA 80 V +L++ GEFL L+GPSGCGKSTTLR++AGL+ T G+I++GD+++T + P DRD+A Sbjct: 22 VANLSLQLQPGEFLTLLGPSGCGKSTTLRLIAGLDQPTSGSIWLGDREITTLPPGDRDMA 81 Query: 81 MVFQNYALYPHMTVGENMGFALKIAGKSQDEINKRVDEAAATLGLTEFLERKPKALSGGQ 140 MVFQ+YALYPH+ V +N+ L+I S EI +R+ + A L L L+R+P LSGGQ Sbjct: 82 MVFQSYALYPHLNVRQNLTLGLQIRRTSAAEIEQRLQQVAHNLELDHLLDRRPAQLSGGQ 141 Query: 141 RQRVAMGRAIVRNPQVFLMDEPLSNLDAKLRVQTRTQIAALQRKLGVTTVYVTHDQTEAL 200 RQRVA+GRA+VR P VFL+DEPLSNLDA LR Q R Q+ AL + VYVTHDQTEAL Sbjct: 142 RQRVALGRALVRQPSVFLLDEPLSNLDALLREQVRAQMKALFSQQASPVVYVTHDQTEAL 201 Query: 201 TMGDRIAVLKDGYLQQVGAPRELYDRPANVFVAGFIGSPAMNLGTFSVKDGDATSGHARI 260 ++ RIA+L G+LQQ+ +P +Y PAN FVAGFIGSP MNL + G A G + Sbjct: 202 SLSHRIAILNGGHLQQLDSPDRIYQAPANAFVAGFIGSPRMNLLPLPIHSGQAWLGSRAL 261 Query: 261 KLSPETLAAMTPEDNGRITIGFRPEALEI-IPEGESTDLSIPIKLDFVEELGSDSFLYGK 319 + P LAA ++ G RPE L++ PE E +IP++L E LG L Sbjct: 262 PI-PSHLAA-----RSQVLWGLRPEHLKLATPEVER---AIPVQLHLTENLGMQRLL--- 309 Query: 320 LVGEGDLGSSSEDVPESGQIVVR-AAPNAAPAPGSVFHARIVEGGQHNFSASTGKRL 375 + + + ++ +R P+ P P + QH F STG RL Sbjct: 310 ----------TVAIAANPEVRLRLLMPSDQPIPTDL-QVTFEPESQHWFCPSTGDRL 355 Lambda K H 0.316 0.135 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 355 Length adjustment: 30 Effective length of query: 346 Effective length of database: 325 Effective search space: 112450 Effective search space used: 112450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory