Align Maltose transport system permease protein malG aka TT_C1629, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate Synpcc7942_0948 Synpcc7942_0948 permease protein of sugar ABC transporter
Query= TCDB::Q72H66 (280 letters) >FitnessBrowser__SynE:Synpcc7942_0948 Length = 275 Score = 202 bits (513), Expect = 9e-57 Identities = 108/260 (41%), Positives = 165/260 (63%), Gaps = 1/260 (0%) Query: 22 VYSVFPFYWAVISSFKPSDALFSPDPSFLPVPFTLEHYENVFLQAN-FGRNLLNSLIVAG 80 ++S+ P W +++S K + + + + P +T+EHY+ ++ Q FGR LLNS +V+ Sbjct: 16 LFSLAPILWQLLTSIKVNADIAAIPTIYWPRQWTVEHYQALWQQTPAFGRYLLNSAVVSA 75 Query: 81 GATLLSLVLGVLAAYALGRLPFPPKNAVMYIVLSMTMFPQIAVLGGLFLLLRQTGLFNTH 140 ATL +L++G AYA+ R ++ +L +T+FP + + GL ++R N + Sbjct: 76 IATLAALLIGTPCAYAIARRRDRSSQVLVGSLLLVTLFPYVLLFQGLLEVVRWLQWGNNY 135 Query: 141 LGLILTYLLFTLPFTVWVLVGYFRGLPRELEEAAYVDGATPLQTLLKVMLPLTGPGLVTT 200 L++ Y LP + +L +F LP ELEEAA +DG + Q L +++PLT P LVT Sbjct: 136 AALVVPYTALNLPLVILLLRSFFEQLPPELEEAAQIDGLSLGQRLWLILVPLTAPALVTA 195 Query: 201 GLLAFIAAWNEYLFALTFTVGDSVKTVPPAIASFGGATPFEIPWGSIMAASVVVTVPLVV 260 G+LAFI +WNEY+ AL+F ++KTVP A+A GG + F++P+G I AA+VV T+PL+ Sbjct: 196 GILAFIFSWNEYVLALSFISQQALKTVPIAVAEIGGISIFDVPYGDIAAATVVATLPLIG 255 Query: 261 LVLVFQQRIVAGLTAGAVKG 280 LVLV Q+RI+ GLTAGAVKG Sbjct: 256 LVLVAQRRILEGLTAGAVKG 275 Lambda K H 0.329 0.145 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 159 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 275 Length adjustment: 25 Effective length of query: 255 Effective length of database: 250 Effective search space: 63750 Effective search space used: 63750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory