Align Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate Synpcc7942_1680 Synpcc7942_1680 Sulphate transport system permease protein 1
Query= SwissProt::Q9YGA6 (372 letters) >FitnessBrowser__SynE:Synpcc7942_1680 Length = 338 Score = 231 bits (590), Expect = 2e-65 Identities = 133/305 (43%), Positives = 190/305 (62%), Gaps = 22/305 (7%) Query: 3 GVRLVDVWKVFGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYI 62 G+++ V K FG AV+++ L V+ G + LLGPSG GK+T LR+IAGLE+P G+I++ Sbjct: 2 GIQVSQVSKQFGSFQAVKDVDLTVETGSLVALLGPSGSGKSTLLRLIAGLEQPDSGRIFL 61 Query: 63 GDKLVADPEKGIFVPPKDRDIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVRE 122 + + +DR I VFQ YAL+ H+TV NIAF L+LRK ++++ RV E Sbjct: 62 TGRDATNESV------RDRQIGFVFQHYALFKHLTVRKNIAFGLELRKHTKEKVRARVEE 115 Query: 123 VAELLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAEL 182 + EL+ LT L +R P +LSGGQRQRVAL RA+ +PQV L+DEP LDAK+R +R+ L Sbjct: 116 LLELVQLTGLGDRYPSQLSGGQRQRVALARALAVQPQVLLLDEPFGALDAKVRKDLRSWL 175 Query: 183 KKLQRQLGVTTIYVTHDQVEAMTMGDRIAVMNRGVLQQVGSPDEVYDKPANTFVAGFIGS 242 +KL ++ VTT++VTHDQ EAM + D+I VMN G ++Q+GSP E+YD PA FV FIG Sbjct: 176 RKLHDEVHVTTVFVTHDQEEAMEVADQIVVMNHGKVEQIGSPAEIYDNPATPFVMSFIG- 234 Query: 243 PPMNFL--DAIVTEDGFVDFGEFRLKLLPDQFEV------------LGELGYVGREVIFG 288 P+N L + + + G +D + L P E+ + + ++G EV Sbjct: 235 -PVNVLPNSSHIFQAGGLDTPHPEVFLRPHDIEIAIDPIPETVPARIDRIVHLGWEVQAE 293 Query: 289 IRPED 293 +R ED Sbjct: 294 VRLED 298 Lambda K H 0.323 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 372 Length of database: 338 Length adjustment: 29 Effective length of query: 343 Effective length of database: 309 Effective search space: 105987 Effective search space used: 105987 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory