Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate Synpcc7942_1414 Synpcc7942_1414 ATPase
Query= TCDB::Q9X271 (324 letters) >FitnessBrowser__SynE:Synpcc7942_1414 Length = 241 Score = 109 bits (272), Expect = 8e-29 Identities = 74/219 (33%), Positives = 118/219 (53%), Gaps = 12/219 (5%) Query: 18 EGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINRNGRIVDGEAIFLGKDLL 77 E V+A+D + +++ GE I+G SGSGKS + + LI R G G D+ Sbjct: 22 ETTVRALDHVDFQVRAGEYCAIMGASGSGKSTA----MNLIGCLDRPTAGRYYLDGTDVA 77 Query: 78 KLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWHRLMKNEEARERAIELLE 137 L+ + L +R + I +FQ L P + VM P+I+ + + +E R+RA+ L Sbjct: 78 DLDDDALAAVRNRKIGFVFQQ--FHLLPQLSAVENVMLPMIYAGISQ-QERRDRAVAALT 134 Query: 138 RVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADEPTTALDVTIQAQIMELL 197 +VG+ + R N P Q SGG +QRV IA A+ P LL+ADEPT ALD +++ + Sbjct: 135 QVGLAQ---RLDNKPNQLSGGQQQRVAIARAIVNQPVLLLADEPTGALDSQTTEEVLNIF 191 Query: 198 QELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEE 236 +L + G++++ +TH+ VA +R+I G+I E Sbjct: 192 DQLHQR-GITIVIVTHEAEVADR-AERVIWFRDGQIQRE 228 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 241 Length adjustment: 26 Effective length of query: 298 Effective length of database: 215 Effective search space: 64070 Effective search space used: 64070 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory