Align Inositol transport system ATP-binding protein (characterized)
to candidate Synpcc7942_0249 Synpcc7942_0249 ATPase
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__SynE:Synpcc7942_0249 Length = 261 Score = 107 bits (267), Expect = 3e-28 Identities = 72/234 (30%), Positives = 119/234 (50%), Gaps = 15/234 (6%) Query: 2 SMSQPLIRMQGIEKHFGSVI-ALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPT 60 S + +I +G+EK +G+ AL GVS+ V GE ++G +G+GKSTF++T++ + Sbjct: 16 SAPETMIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQ 75 Query: 61 KGDILFEGQPLHFADPRD--AIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRK--IGPL 116 +G+I EG L D RD I + V Q + P ++V +N + +R+ + Sbjct: 76 RGEIWIEGHRLSH-DRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQA 134 Query: 117 KLFDHDYANRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPT 176 + R+ + E D+ G LSGG++Q VAIARA+ ++L+ DEPT Sbjct: 135 EATARQLLERVRIAEQA---------DKYPGQLSGGQQQRVAIARALAMQPRILLFDEPT 185 Query: 177 SALGVRQTANVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTA 230 SAL VL + + +G+ ++ TH V A V DR ++ G+ + A Sbjct: 186 SALDPEMVREVLDVMRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEA 239 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 261 Length adjustment: 25 Effective length of query: 236 Effective length of database: 236 Effective search space: 55696 Effective search space used: 55696 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory