Align phenylpyruvate decarboxylase (EC 4.1.1.43) (characterized)
to candidate Synpcc7942_1944 Synpcc7942_1944 Pyruvate dehydrogenase (lipoamide)
Query= BRENDA::A0A222AKA3 (368 letters) >FitnessBrowser__SynE:Synpcc7942_1944 Length = 342 Score = 143 bits (361), Expect = 6e-39 Identities = 101/330 (30%), Positives = 150/330 (45%), Gaps = 26/330 (7%) Query: 35 AGVPPDRQLLMYRAMVVGRAFNRQATAFSRQGRLAVYPSS-RGQEACQVGSALAVRPTDW 93 A V + L +Y MV+GR F + +G++ + GQEA G A+R D+ Sbjct: 15 AQVSREEGLRIYEDMVLGRTFEDKCAEMYYRGKMFGFVHLYNGQEAVASGIIKAMRSDDY 74 Query: 94 LFPTYRESVALLTRGIDPVQVLT-LFRGDQHC-------------------GYDPVTEHT 133 + TYR+ V L+ G+ QV+ LF + C G+ V E Sbjct: 75 VCSTYRDHVHALSAGVPARQVMAELFGKETGCSRGRGGSMHLFSAEHNLLGGFAFVAEGI 134 Query: 134 APQCTPLATQCLHAAGLADAARMAGDPIVALAYIGDGATSEGDFHEALNYAAVRRAPVVF 193 T L D + D + A + GDGA + G F E LN A + + P++F Sbjct: 135 PVATGAAFTTAYRRNALGDTS---ADQVTA-CFFGDGAANNGQFFECLNMATLWKLPILF 190 Query: 194 LVQNNQYAISVPLAKQTAARTLADKAAGYGMPGVRIDGNDVLQVYRAVHDAAERARAGHG 253 +V+NN++AI + + T+ + K +GMPGV +DG DVL V +A RARAG G Sbjct: 191 VVENNKWAIGMSHERATSDPEIYKKGPAFGMPGVEVDGMDVLAVRAVAQEAIARARAGEG 250 Query: 254 PTLIEAVTYRIDAHTNADDDTRYRPAGEADVWAAQDPVDRLERDLLAAGVLDRAAADGIA 313 PTLIEA+TYR H+ AD D R E + W A+DP+ R L + I Sbjct: 251 PTLIEALTYRFRGHSLADPD-ELRSKEEKEFWLARDPIKRFAAHLTEFNLATHEELKAID 309 Query: 314 AAADAFAGELSARFSAPPTGDPMQMFRHVY 343 +A E + P P ++ R+++ Sbjct: 310 KKIEALVAEAVEFAISSPEPKPEELTRYIW 339 Lambda K H 0.319 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 255 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 342 Length adjustment: 29 Effective length of query: 339 Effective length of database: 313 Effective search space: 106107 Effective search space used: 106107 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory