Align BadI (characterized)
to candidate Synpcc7942_0597 Synpcc7942_0597 naphthoate synthase
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__SynE:Synpcc7942_0597 Length = 279 Score = 240 bits (612), Expect = 3e-68 Identities = 130/265 (49%), Positives = 168/265 (63%), Gaps = 8/265 (3%) Query: 2 QFEDLIYE-IRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDR 60 ++ED+ YE G+A I INRP K NAFR T EL A A D +G I+L GAG Sbjct: 11 EYEDIRYEKCAEGIAKITINRPHKRNAFRPKTVVELYDAFCDAREDIAIGVILLTGAGPH 70 Query: 61 -----AFCTGGDQSTHD--GNYDGRGTVGLPMEELHTAIRDVPKPVIARVQGYAIGGGNV 113 AFC GGDQS G D G L + +L IR +PK VIA V GYAIGGG+V Sbjct: 71 TDGRYAFCAGGDQSVRGAGGYIDEEGLPRLNVLDLQRLIRTIPKVVIALVAGYAIGGGHV 130 Query: 114 LATICDLTICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAE 173 L +CDLTI ++ A+FGQ GPK+GS D G+G ++LAR+VG+KKAREIW++C++Y KEA Sbjct: 131 LHILCDLTIAADNAVFGQTGPKVGSFDGGFGASYLARLVGQKKAREIWFLCRQYGAKEAL 190 Query: 174 AMGLANLCVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDTAHQAGIAGMGMYALKL 233 MGL N VP +EL+AE +W E+ E+SP A+ K +FN + AGI + +A L Sbjct: 191 QMGLVNTVVPVEELEAEGIRWALEILEKSPIAIRCLKAAFNAELDGMAGIQELAGHATHL 250 Query: 234 YYDTDESREGVKALQEKRKPEFRKY 258 YY T+E EG +A EKR P+FR+Y Sbjct: 251 YYLTEEGSEGKQAFLEKRSPDFRQY 275 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 279 Length adjustment: 25 Effective length of query: 235 Effective length of database: 254 Effective search space: 59690 Effective search space used: 59690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory