Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate Synpcc7942_2495 Synpcc7942_2495 integral membrane protein of the ABC-type Nat permease for neutral amino acids NatD
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__SynE:Synpcc7942_2495 Length = 313 Score = 191 bits (485), Expect = 2e-53 Identities = 117/317 (36%), Positives = 179/317 (56%), Gaps = 25/317 (7%) Query: 4 FLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFV--ALI--TFLAIGS 59 +LQ LINGL++G +Y L A+GYT+V+ I+G+INFAHG ++ +GA++ AL+ F G Sbjct: 3 WLQPLINGLAIGGVYALFALGYTLVFSILGVINFAHGAVFTLGAYLTYALVGGRFSFNGL 62 Query: 60 LGITWVPLAL---LVMLVASMLFTAVYGWTVERIAYRPLR--SSPRLAPLISAIGMSIFL 114 L +P +L L +L+ S+L +E++A+RPLR + L LIS++G+++F+ Sbjct: 63 LANAALPFSLPFALALLLGSLLAGGA-SLLIEQVAFRPLRRRQADPLLTLISSLGVAVFI 121 Query: 115 QNYVQILQGARSKPLQPILPG------NLTLMDGAVSVSYVRLATIVITIALMYGFTQLI 168 N +QIL GA + G NL D + + V++ V+ IA+ T LI Sbjct: 122 VNLIQILVGAEIYTFPSNIYGDLPSAINLGSSDRPIQIRTVQIILFVVAIAMFSLLTWLI 181 Query: 169 TRTSLGRAQRACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIG 228 T +G A +A +D A LLG++ DR I LTF + L +AG +V + Y G Sbjct: 182 NGTRVGHALKAVAEDATTASLLGIDPDRYIRLTFFLSGVLGGLAGTLVGTSVSITGPYFG 241 Query: 229 FLAGVKAFTAAVLGGIGSLPGAMLGGVVIGLIEAF----WSGYMGSEWKDVATFTILVLV 284 G+K + VLGG+G++PG + GG+++GL EA+ WSGY +D F +L + Sbjct: 242 IAYGLKGLSVMVLGGLGNIPGTIAGGLLLGLAEAWVPPQWSGY-----RDAVAFALLFAM 296 Query: 285 LIFRPTGLLGRPEIEKV 301 L+ RP GL R EKV Sbjct: 297 LLIRPQGLFSRARTEKV 313 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 313 Length adjustment: 27 Effective length of query: 274 Effective length of database: 286 Effective search space: 78364 Effective search space used: 78364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory