GapMind for catabolism of small carbon sources

 

Aligments for a candidate for prpE in Synechococcus elongatus PCC 7942

Align Acetyl-coenzyme A synthetase; AcCoA synthetase; Acs; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 (characterized)
to candidate Synpcc7942_1352 Synpcc7942_1352 acetyl-CoA synthetase

Query= SwissProt::P31638
         (660 letters)



>lcl|FitnessBrowser__SynE:Synpcc7942_1352 Synpcc7942_1352 acetyl-CoA
           synthetase
          Length = 656

 Score =  758 bits (1956), Expect = 0.0
 Identities = 376/658 (57%), Positives = 480/658 (72%), Gaps = 12/658 (1%)

Query: 4   IESVMQEHRVFNPPEGFASQAAIPSMEAYQALCDEAERDYEGFWARHARELLHWTKPFTK 63
           IES++QE RVF P   FAS A I + EAY+ALC +A  D   FW   A + L W +P+ +
Sbjct: 6   IESILQEKRVFPPSAEFASAARI-NPEAYEALCQKAAADPVAFWGELAAQELDWFEPWQQ 64

Query: 64  VLDQSNAPFYKWFEDGELNASYNCLDRNLQNGNADKVAIVFEADDGSVTRVTYRELHGKV 123
            LD SN PF KWF  G+LN S+NCLDR+L     +K AI++E + G    +TY +LH +V
Sbjct: 65  TLDWSNPPFAKWFVGGKLNISHNCLDRHLTTWRKNKAAIIWEGEPGDSRTLTYAQLHREV 124

Query: 124 CRFANGLKALGIRKGDRVVIYMPMSVEGVVAMQACARLGATHSVVFGGFSAKSLQERLVD 183
           C+FAN LK+LGI+KGD V +YMPM  E  +AM ACAR+GA HSVVFGGFSA++L++RLVD
Sbjct: 125 CQFANVLKSLGIQKGDVVGVYMPMIPEAAIAMLACARIGAVHSVVFGGFSAEALRDRLVD 184

Query: 184 VGAVALITADEQMRGGKALPLKAIADDALALGGCEAVRNVIVYRRTGGKVAWTEGRDRWM 243
             A  ++TAD   R    +PLK   D AL    C +V++V+V  RT   +    GRD W 
Sbjct: 185 GQAKLVVTADGGWRKDAIVPLKDSVDQALEGNACPSVQHVLVVERTKQDIHMEPGRDHWW 244

Query: 244 EDVSAGQPDTCEAEPVSAEHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMKWTFDIKP 303
            ++      TC AEP+ +E  LFVLYTSGSTGKPKGV H+TGGY L+A +T +WTFD++ 
Sbjct: 245 HELQQTVSATCPAEPMDSEDLLFVLYTSGSTGKPKGVVHTTGGYNLYAHITTQWTFDLQD 304

Query: 304 DDLFWCTADIGWVTGHTYIAYGPLAAGATQVVFEGVPTYPNAGRFWDMIARHKVSIFYTA 363
            D++WCTAD+GW+TGH+YI YGPL+ GAT +++EG P   N G FWD+I ++ V+ FYTA
Sbjct: 305 TDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRASNPGCFWDVIEKYGVTTFYTA 364

Query: 364 PTAIRSLIKAAEADEKIHPKQYDLSSLRLLGTVGEPINPEAWMWYYKNIGNERCPIVDTF 423
           PTAIR+ IK  E     HP   DLSSLRLLGTVGEPINPEAW+WY++ IG +RCPIVDT+
Sbjct: 365 PTAIRAFIKMGEQ----HPAARDLSSLRLLGTVGEPINPEAWIWYHRVIGGDRCPIVDTW 420

Query: 424 WQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAIVDETGHDVPNGNGGILVVKRPWPAM 483
           WQTETGGHMIT LPGA P  PGS T P PGI+A +VD  G  VP+  GG LV++ PWP M
Sbjct: 421 WQTETGGHMITSLPGAVPTKPGSATKPFPGILADVVDLDGRSVPDNEGGYLVIRHPWPGM 480

Query: 484 IRTIWGDPERFRKSYF---PEELGGKLYLAGDGSIRDKDTGYFTIMGRIDDVLNVSGHRM 540
           +RT++GDP+RFR++Y+   P + G  LY AGDG+ RD D GYF +MGR+DDV+NVSGHR+
Sbjct: 481 MRTVYGDPDRFRRTYWEHIPPQNGQYLYFAGDGARRDAD-GYFWVMGRVDDVINVSGHRL 539

Query: 541 GTMEIESALVSNPLVAEAAVVGRPDDMTGEAICAFVVLKRSRPTGEEAVKIATELRNWVG 600
           GTMEIESALVS+P VAEAAVVGRPDD+ GE I AF+ L+    TG+E VK   +L+  V 
Sbjct: 540 GTMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFITLESGIETGDELVK---DLKKHVA 596

Query: 601 KEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEEITQDTSTLENPAILEQLKQ 658
           +EIG IA+P +IRF + LPKTRSGKIMRRLLRSLA G+E++ DTSTLE+ ++L++L+Q
Sbjct: 597 QEIGAIARPDEIRFSEALPKTRSGKIMRRLLRSLAAGQEVSGDTSTLEDRSVLDKLRQ 654


Lambda     K      H
   0.319    0.136    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1408
Number of extensions: 67
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 660
Length of database: 656
Length adjustment: 38
Effective length of query: 622
Effective length of database: 618
Effective search space:   384396
Effective search space used:   384396
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory