Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate Synpcc7942_1406 Synpcc7942_1406 ATPase
Query= TCDB::P31134 (377 letters) >FitnessBrowser__SynE:Synpcc7942_1406 Length = 368 Score = 221 bits (564), Expect = 2e-62 Identities = 136/332 (40%), Positives = 196/332 (59%), Gaps = 31/332 (9%) Query: 19 LLEIRNLTKSYDGQH--AVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQI 76 +L + + K + G AVD VS + GEI L+G SGCGK+TLLRM+AGFE +G I Sbjct: 6 VLCLDRVCKQFSGSSLAAVDQVSFELEAGEILGLVGPSGCGKTTLLRMIAGFESLQSGSI 65 Query: 77 MLDGVDLS----QVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNE 132 L G ++ +PP R + M+FQ YALFPH+TV N+ FGL+ D+ A +A + Sbjct: 66 QLAGETVATAQRSLPPETRSVGMVFQDYALFPHLTVLDNVCFGLR-DRKGSAAVA---RQ 121 Query: 133 MLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEV 192 L LV ++ +R PH+LSGGQ+QRVALAR+LA +P L+LLDEP+ LD ++R R++ E+ Sbjct: 122 ALALVGLEGLERRYPHELSGGQQQRVALARALAPQPPLILLDEPLSNLDVQVRLRLRQEL 181 Query: 193 VDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGS 252 DIL + T ++VTHDQEEA+++ R+A+M G+F QIG+PEE+++HP +R+ AEF+ Sbjct: 182 RDILRQAQATAILVTHDQEEALSICDRVAVMRLGRFEQIGQPEELFQHPASRFVAEFLSQ 241 Query: 253 VNVFEGVLKERQEDG--LVL---DSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEE 307 N + E Q D VL ++PG + S P V +R E ++L Sbjct: 242 ANF---LATEYQGDAWRTVLGDFEAPG-------GLEGSRTGGEPPVVMVRQEDVLLHPH 291 Query: 308 PPANGCNFAVGEVIHIAYLGDLSVYHVRLKSG 339 P G V +LG Y V+L +G Sbjct: 292 PEGTGL------VRDRQFLGRDYRYFVQLPAG 317 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 368 Length adjustment: 30 Effective length of query: 347 Effective length of database: 338 Effective search space: 117286 Effective search space used: 117286 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory