Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate Synpcc7942_1406 Synpcc7942_1406 ATPase
Query= reanno::acidovorax_3H11:Ac3H11_2941 (350 letters) >FitnessBrowser__SynE:Synpcc7942_1406 Length = 368 Score = 189 bits (481), Expect = 7e-53 Identities = 120/330 (36%), Positives = 169/330 (51%), Gaps = 13/330 (3%) Query: 18 AIKGIDLTIQQGEFIVFVGPSGCGKSTLLRLIAGLEAIDGGSLMLDGRDITDQ----PSS 73 A+ + ++ GE + VGPSGCGK+TLLR+IAG E++ GS+ L G + P Sbjct: 23 AVDQVSFELEAGEILGLVGPSGCGKTTLLRMIAGFESLQSGSIQLAGETVATAQRSLPPE 82 Query: 74 KRDLAMVFQSYALYPHMSVYENMSFALKLAKVDKQVIDEKVQNAARILNLTQYLQRTPKE 133 R + MVFQ YAL+PH++V +N+ F L+ K V + A ++ L +R P E Sbjct: 83 TRSVGMVFQDYALFPHLTVLDNVCFGLRDRKGSAAV----ARQALALVGLEGLERRYPHE 138 Query: 134 LSGGQRQRVAIGRAIVRAPKVFLFDEPLSNLDAALRGQTRVEIAKLHRDLGATTIYVTHD 193 LSGGQ+QRVA+ RA+ P + L DEPLSNLD +R + R E+ + R AT I VTHD Sbjct: 139 LSGGQQQRVALARALAPQPPLILLDEPLSNLDVQVRLRLRQELRDILRQAQATAILVTHD 198 Query: 194 QVEAMTLADRVVVLRDGIIEQVGTPLELYDKPANQFVAQFIGTPQMNVVPVDKLPQPVQQ 253 Q EA+++ DRV V+R G EQ+G P EL+ PA++FVA+F+ Sbjct: 199 QEEALSICDRVAVMRLGRFEQIGQPEELFQHPASRFVAEFLSQANFLATEYQGDAWRTVL 258 Query: 254 QAPAAPAGAAVGAIGLRPENITVRTTGAT----PVG-GQVDLIEALGAETLIYVTTPGGA 308 AP G G P + VR P G G V + LG + +V P G Sbjct: 259 GDFEAPGGLEGSRTGGEPPVVMVRQEDVLLHPHPEGTGLVRDRQFLGRDYRYFVQLPAGL 318 Query: 309 QFVSRQNDRTDLRVGDAVSLDIDASQAHWF 338 + + VG AV + + QA + Sbjct: 319 EIQVLGPVSEAIAVGTAVQVQLRTGQARLY 348 Lambda K H 0.320 0.137 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 368 Length adjustment: 29 Effective length of query: 321 Effective length of database: 339 Effective search space: 108819 Effective search space used: 108819 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory