Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate Synpcc7942_0471 Synpcc7942_0471 ABC-type sugar transport system permease component-like
Query= uniprot:A8LLL4 (385 letters) >FitnessBrowser__SynE:Synpcc7942_0471 Length = 276 Score = 113 bits (283), Expect = 6e-30 Identities = 72/238 (30%), Positives = 119/238 (50%), Gaps = 13/238 (5%) Query: 153 PPEF-----TFANYENMLLDPNNSEGMARAFFNTLTVTIPATIIPILVAAFAAYALAWME 207 PP+F T N+ + + + + F N+ V + + +L + AAY LA +E Sbjct: 46 PPQFLPTQPTLDNFRRVWTE----NPLGQYFLNSTWVALLTVGLNLLFCSLAAYPLARLE 101 Query: 208 FPGRALLIALIVGLLVVPLQLALIPLLTLHNAIGIGKGYLGTWLAHTGFGMPLAIYLLRN 267 F GR L LIV +++P Q+ +IPL L +G+ YLG L I+LLR Sbjct: 102 FKGRQTLFLLIVATILIPFQVVMIPLYVLIINLGLRNTYLG--LVFPYLASAFGIFLLRQ 159 Query: 268 YMVGLPRDIIENAKVDGATDFQIFTKIVLPLSFPALASFAIFQFLWTWNDLLVAKVFLID 327 G+P+D+ E A++DG D ++ +++P + PAL + AIF F+ +W+D L + L + Sbjct: 160 AFQGIPKDLEEAARIDGCNDLGVWWNVMIPSARPALITLAIFVFIGSWSDFLWPLIILDE 219 Query: 328 ATGQTTVMTNQIVELLGTRGGNWEILATAAFVSIAVPLLVFFSMQRFLVRGLLAGSVK 385 T + I L +W ++A + +SI VF ++QR++V A VK Sbjct: 220 PDRYTLPL--GIATLASGFSLDWRLVAAGSVLSILPVFGVFLALQRYIVPSAAASGVK 275 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 276 Length adjustment: 28 Effective length of query: 357 Effective length of database: 248 Effective search space: 88536 Effective search space used: 88536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory