Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate Synpcc7942_0947 Synpcc7942_0947 ATPase
Query= uniprot:A8LLL2 (373 letters) >FitnessBrowser__SynE:Synpcc7942_0947 Length = 355 Score = 249 bits (636), Expect = 8e-71 Identities = 154/357 (43%), Positives = 212/357 (59%), Gaps = 21/357 (5%) Query: 4 LKLTGVEKAYG-DVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTLEI 62 L+L + KAY V ++N++L +Q GE + +GPSGCGKST LR+IAGL++ T G++ + Sbjct: 6 LELRQLRKAYSPSVVPVANLSLQLQPGEFLTLLGPSGCGKSTTLRLIAGLDQPTSGSIWL 65 Query: 63 DGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEKLQ 122 + +PP R +AMVFQSYALYPH+ VR+N++ L+I + S AEI+ ++ A L+ Sbjct: 66 GDREITTLPPGDRDMAMVFQSYALYPHLNVRQNLTLGLQIRRTSAAEIEQRLQQVAHNLE 125 Query: 123 LGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLKEA 182 L LDR P LSGGQRQRVA+GR++VR P V+L DEPLSNLDA LR R ++ L + Sbjct: 126 LDHLLDRRPAQLSGGQRQRVALGRALVRQPSVFLLDEPLSNLDALLREQVRAQMKAL-FS 184 Query: 183 MPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKMNL 242 S +VYVTHDQ EA++L+ RI +L GG + Q+ SP +Y+ P N FVA FIGSP+MNL Sbjct: 185 QQASPVVYVTHDQTEALSLSHRIAILNGGHLQQLDSPDRIYQAPANAFVAGFIGSPRMNL 244 Query: 243 LPGKIIGTGAQTTVEMTDGGRAVSDYPSDDSLMG-AAVNVGVRPEDMVEAAPGGDYVFEG 301 LP I A G RA+ P L + V G+RPE + A P + Sbjct: 245 LPLPIHSGQAWL------GSRAL---PIPSHLAARSQVLWGLRPEHLKLATPEVERAIPV 295 Query: 302 KVAITEALGEVTLLYFEAPSGEDPTIGKL----QGIHKDLKGQVTRLTAEPAKVHVF 354 ++ +TE LG LL + + + L Q I DL ++T EP H F Sbjct: 296 QLHLTENLGMQRLLTVAIAANPEVRLRLLMPSDQPIPTDL-----QVTFEPESQHWF 347 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 355 Length adjustment: 29 Effective length of query: 344 Effective length of database: 326 Effective search space: 112144 Effective search space used: 112144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory