Align Glucokinase; EC 2.7.1.2; Glucose kinase (uncharacterized)
to candidate Synpcc7942_0221 Synpcc7942_0221 glucokinase
Query= curated2:B2J224 (341 letters) >lcl|FitnessBrowser__SynE:Synpcc7942_0221 Synpcc7942_0221 glucokinase Length = 345 Score = 347 bits (890), Expect = e-100 Identities = 188/344 (54%), Positives = 232/344 (67%), Gaps = 6/344 (1%) Query: 1 MTLLLAGDIGGTKTILQLVETSDSQGLHTIYQESYHSADFPDLVPIVQQFLI---KANTP 57 MTLLLAGDIGGTKT L L SD L ++Q S+ SA +PDLVP+VQ+FL A Sbjct: 1 MTLLLAGDIGGTKTNLMLAIASDCDRLEPLHQASFASAAYPDLVPMVQEFLAAAPSAEVR 60 Query: 58 IPEKACFAIAGPIVKNTAKLTNLAWFLDTERLQQELGIPHIYLINDFAAVGYGISGLQKQ 117 P ACF IAGP+V TAKLTNL W L RL +ELGI + LINDFAA+ YG+ GL + Sbjct: 61 SPVVACFGIAGPVVHGTAKLTNLPWQLSEARLAKELGIAQVALINDFAAIAYGLPGLTAE 120 Query: 118 DLHPLQVGKPQPETPIGIIGAGTGLGQGFLIKQGNNYQVFPSEGGHADFAPRNEIEFQLL 177 D +QVG+ P PI I+GAGTGLG+GF+I QVF SEG HADFAP+ E+E +LL Sbjct: 121 DQVVVQVGEADPAAPIAILGAGTGLGEGFIIPTAQGRQVFGSEGSHADFAPQTELESELL 180 Query: 178 KYLLDKHDIQRISVERVVSGMGIVAIYQFLRDRKFAAESPDIAQIVRTWEQEAGQEEKSV 237 +L + + I+ ISVERVVSG GI AIY FLRDR E+P + I W+ Q + Sbjct: 181 HFLRNFYAIEHISVERVVSGQGIAAIYAFLRDRHPDQENPALGAIASAWQTGGDQ---AP 237 Query: 238 DPGAAIGTAALEKRDRLSEQTLQLFIEAYGAEAGNLALKLLPYGGLYIAGGIAPKILPLI 297 D AA+ AAL RD L+ Q +Q+F+ AYGAEAGNLALKLL YGG+Y+AGGIA KILPL+ Sbjct: 238 DLAAAVSQAALSDRDPLALQAMQIFVSAYGAEAGNLALKLLSYGGVYVAGGIAGKILPLL 297 Query: 298 QNSGFLLNFTQKGRMRPLLEEIPVYIILNPQVGLIGAALCAARL 341 + FL F KGR++ LL +P+ I+ N +VGLIGA L AA + Sbjct: 298 TDGTFLQAFQAKGRVKGLLTRMPITIVTNHEVGLIGAGLRAAAI 341 Lambda K H 0.320 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 345 Length adjustment: 29 Effective length of query: 312 Effective length of database: 316 Effective search space: 98592 Effective search space used: 98592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Synpcc7942_0221 Synpcc7942_0221 (glucokinase)
to HMM TIGR00749 (glk: glucokinase (EC 2.7.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00749.hmm # target sequence database: /tmp/gapView.7866.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00749 [M=315] Accession: TIGR00749 Description: glk: glucokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-105 336.7 0.3 8.5e-105 336.4 0.3 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_0221 Synpcc7942_0221 glucokinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_0221 Synpcc7942_0221 glucokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 336.4 0.3 8.5e-105 8.5e-105 1 315 [] 5 335 .. 5 335 .. 0.95 Alignments for each domain: == domain 1 score: 336.4 bits; conditional E-value: 8.5e-105 TIGR00749 1 lvgdiGGtnarlalv.evapgeieqv..ktyssedfpsleavvrvyleea.kvelkdpikgcfaiatPi 65 l+gdiGGt++ l l + ++e++ + s ++p+l+++v+ +l a e++ p+ +cf ia+P+ lcl|FitnessBrowser__SynE:Synpcc7942_0221 5 LAGDIGGTKTNLMLAiASDCDRLEPLhqASFASAAYPDLVPMVQEFLAAApSAEVRSPVVACFGIAGPV 73 79**********99544445677777667899***************98736799************** PP TIGR00749 66 igdfvrltnldWalsieelkqelalaklelindfaavayailalkeedliqlggakveesaaiailGaG 134 + + +ltnl W+ls ++l++el++a++ lindfaa+ay++++l ed ++++ +++++a+iailGaG lcl|FitnessBrowser__SynE:Synpcc7942_0221 74 VHGTAKLTNLPWQLSEARLAKELGIAQVALINDFAAIAYGLPGLTAEDQVVVQVGEADPAAPIAILGAG 142 ********************************************************************* PP TIGR00749 135 tGlGvatliqqsdgrykvlageGghvdfaPrseleillleylrkky..grvsaervlsGsGlvliyeal 201 tGlG ++i+ ++gr +v+ +eG+h+dfaP+ ele ll++lr+ y +++s+erv+sG+G++ iy +l lcl|FitnessBrowser__SynE:Synpcc7942_0221 143 TGLGEGFIIPTAQGR-QVFGSEGSHADFAPQTELESELLHFLRNFYaiEHISVERVVSGQGIAAIYAFL 210 **********99999.79**************************98889******************** PP TIGR00749 202 skrkgere...vsklskeelkekd........iseaalegsdvlarralelflsilGalagnlalklga 259 + r++++e + + ++++ d +s+aal + d+la +a+++f+s++Ga+agnlalkl++ lcl|FitnessBrowser__SynE:Synpcc7942_0221 211 RDRHPDQEnpaLGAIASAWQTGGDqapdlaaaVSQAALSDRDPLALQAMQIFVSAYGAEAGNLALKLLS 279 ******997887888889998888999****************************************** PP TIGR00749 260 rGGvyvaGGivPrfiellkkssfraafedkGrlkellasiPvqvvlkkkvGllGag 315 +GGvyvaGGi+ ++++ll ++f +af+ kGr+k ll+ +P+ +v +++vGl+Gag lcl|FitnessBrowser__SynE:Synpcc7942_0221 280 YGGVYVAGGIAGKILPLLTDGTFLQAFQAKGRVKGLLTRMPITIVTNHEVGLIGAG 335 ******************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (315 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.70 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory