Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate Synpcc7942_1501 Synpcc7942_1501 D-3-phosphoglycerate dehydrogenase
Query= BRENDA::F8A9V0 (325 letters) >FitnessBrowser__SynE:Synpcc7942_1501 Length = 546 Score = 164 bits (414), Expect = 6e-45 Identities = 97/246 (39%), Positives = 140/246 (56%), Gaps = 17/246 (6%) Query: 70 LLALRSAGYDHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIMLALIRRLHRAHDKVRLG 129 ++ G D++D+ A R GI VVN P + A A+HTLA+ML+L R + A+ + G Sbjct: 83 IIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEHTLAMMLSLSRHIPDANASTKSG 142 Query: 130 DFDLDGLMGFDLNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYDPYIQPEIVEN-----V 184 +D +G ++ K GV+GLGKIG VAT KA G K+L YDP+I E E V Sbjct: 143 GWDRKSFVGTEVYKKTLGVVGLGKIGSHVATVAKAMGMKLLAYDPFISAERAEQIGARLV 202 Query: 185 DLDTLITQADIISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGLIDTKALLEALKS 244 +LD L +AD I++H P T E ++ N ET +MKP ++N ARGG+I+ +AL +A+ + Sbjct: 203 ELDILFQEADYITLHIPKTPETANLINAETLAKMKPTTRIINCARGGVINEQALADAIAA 262 Query: 245 GKLGGAALDVYEYERGLFFKNHQKEGIKDPYLAQLLGLANVVLTGHQAFLTREAVKNIEE 304 GK+GGAALDVY+ +E ++ + LG N++LT H T EA N+ Sbjct: 263 GKIGGAALDVYD-----------QEPLQADSPLRALG-KNLILTPHLGASTTEAQVNVAV 310 Query: 305 TTVENI 310 E I Sbjct: 311 DVAEQI 316 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 393 Number of extensions: 23 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 546 Length adjustment: 32 Effective length of query: 293 Effective length of database: 514 Effective search space: 150602 Effective search space used: 150602 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory