Align aminomethyltransferase; EC 2.1.2.10 (characterized)
to candidate Synpcc7942_2308 Synpcc7942_2308 glycine cleavage system aminomethyltransferase T
Query= CharProtDB::CH_000563 (364 letters) >FitnessBrowser__SynE:Synpcc7942_2308 Length = 372 Score = 251 bits (640), Expect = 3e-71 Identities = 150/366 (40%), Positives = 208/366 (56%), Gaps = 16/366 (4%) Query: 5 TPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRTRE 64 +PL+ T GAR F GW +PL + + EH AVR AG+FD+SHM LRGS R Sbjct: 12 SPLHSVCTSAGARFTGFAGWELPLQFQGLMQEHLAVRERAGLFDISHMGKFQLRGSGLRA 71 Query: 65 FLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYF-----TEDFFRLVVNSATRE 119 L+ LL +D+ L G+A YS +LN +GG +DDLIVY+ E F L+VN+AT + Sbjct: 72 ALQRLLPSDLTTLLP-GQAQYSVLLNEAGGCLDDLIVYWQGIVDGVEQAF-LIVNAATTD 129 Query: 120 KDLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQA 179 D W+T+H P + + DL+++A+QGP A A L + + + Sbjct: 130 SDRLWLTEHLPPAIALLDLSQDLALVAIQGPQAIAFLQPLVSCDLAELPRFSHTVTSIAG 189 Query: 180 GDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYGQE 239 F+A TGYTGE G E+ LP A W+ L AGV PCGLGARDTLRLEA M LYG E Sbjct: 190 QPAFVARTGYTGEDGCEVMLPPAAAITLWQQLTAAGVVPCGLGARDTLRLEAAMPLYGHE 249 Query: 240 MDETISPLAANMGWTIAWEPADRDFIGREALEVQREHGTE-KLVGLVMTEKGVLRNELPV 298 +D +PL A +GW + + + DF+GR+ L + +G E +LVGL + + + R+ PV Sbjct: 250 LDTDTNPLEAGLGWVVHLD-RNPDFLGRDRLVQAKTNGLERRLVGLELPGRNIARHGYPV 308 Query: 299 RFTDAQGNQHEGIITSGTFSPTLGYSIALARVP---EGIGETAIVQIRNREMPVKVTKPV 355 D GI+TSG++SPTL +IALA VP +G+ V+IR +++P V K Sbjct: 309 AIADTT----VGIVTSGSWSPTLSKAIALAYVPPALANLGQELWVEIRGKQVPATVVKRP 364 Query: 356 FVRNGK 361 F R + Sbjct: 365 FYRGSQ 370 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 372 Length adjustment: 30 Effective length of query: 334 Effective length of database: 342 Effective search space: 114228 Effective search space used: 114228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate Synpcc7942_2308 Synpcc7942_2308 (glycine cleavage system aminomethyltransferase T)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.12304.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-135 436.9 0.0 3e-135 436.7 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_2308 Synpcc7942_2308 glycine cleavage Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_2308 Synpcc7942_2308 glycine cleavage system aminomethyltransferase T # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 436.7 0.0 3e-135 3e-135 3 361 .. 11 367 .. 9 368 .. 0.98 Alignments for each domain: == domain 1 score: 436.7 bits; conditional E-value: 3e-135 TIGR00528 3 rtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrllan 71 pL+ t+ g++ + faGwelP+q+++l++eh avr+ aGlfD+shmgk++l+Gs +++Lqrll++ lcl|FitnessBrowser__SynE:Synpcc7942_2308 11 SSPLHSVCTSAGARFTGFAGWELPLQFQGLMQEHLAVRERAGLFDISHMGKFQLRGSGLRAALQRLLPS 79 579****************************************************************** PP TIGR00528 72 DvdaLtkGkaqysvllnaqGGvvDDlivykeged...nrfllvvnaataekDlewlkehleeevtldtl 137 D+ L +G+aqysvlln GG +DDlivy +g ++ l+vnaat++ D+ wl+ehl++ + l +l lcl|FitnessBrowser__SynE:Synpcc7942_2308 80 DLTTLLPGQAQYSVLLNEAGGCLDDLIVYWQGIVdgvEQAFLIVNAATTDSDRLWLTEHLPPAIALLDL 148 *****************************998543455889**************************** PP TIGR00528 138 skeisllalqGPkaktiledlldkaveglkefffvqeaelalkkaliartGytGedGfeiavanekave 206 s++++l+a+qGP+a + l++l++ ++ +l+ f + + +a++ a++artGytGedG e+++++ a+ lcl|FitnessBrowser__SynE:Synpcc7942_2308 149 SQDLALVAIQGPQAIAFLQPLVSCDLAELPRFSHT-VTSIAGQPAFVARTGYTGEDGCEVMLPPAAAIT 216 **********************************9.899****************************** PP TIGR00528 207 lwkklveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkkerkksdfiGravleeqk 275 lw++l +a gv P+GLgarDtLrlea m+LyG+eld ++ Pleaglgwvv+++ ++ df+Gr+ l + k lcl|FitnessBrowser__SynE:Synpcc7942_2308 217 LWQQLTAA-GVVPCGLGARDTLRLEAAMPLYGHELDTDTNPLEAGLGWVVHLD-RNPDFLGRDRLVQAK 283 ********.********************************************.89************* PP TIGR00528 276 engtekklvGlemlekgiarnelkvlltngekevGivtsGtlsPtLgknialayvdkelekiGtkleve 344 ng e++lvGle+ ++iar++++v ++++vGivtsG+ sPtL k+ialayv+ l++ G++l ve lcl|FitnessBrowser__SynE:Synpcc7942_2308 284 TNGLERRLVGLELPGRNIARHGYPVAI--ADTTVGIVTSGSWSPTLSKAIALAYVPPALANLGQELWVE 350 ***************************..667************************************* PP TIGR00528 345 vrnklvkikvvkklfvr 361 +r+k+v++ vvk++f+r lcl|FitnessBrowser__SynE:Synpcc7942_2308 351 IRGKQVPATVVKRPFYR 367 ****************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (372 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.02 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory