Align L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 (uncharacterized)
to candidate Synpcc7942_0459 Synpcc7942_0459 glutathione-dependent formaldehyde dehydrogenase
Query= curated2:Q8R7K0 (347 letters) >FitnessBrowser__SynE:Synpcc7942_0459 Length = 369 Score = 104 bits (259), Expect = 4e-27 Identities = 105/362 (29%), Positives = 159/362 (43%), Gaps = 50/362 (13%) Query: 20 VKKEIPKIGPDEVLIKVKATSICGTDVHIYVWNEWAKSRIKP----PKTMGHEFVGEVVE 75 V + P+ G EV++K+ AT +C TD + S P P +GHE G VVE Sbjct: 20 VDVQAPQAG--EVMVKLVATGVCHTDA-------FTLSGADPEGIFPCILGHEGAGIVVE 70 Query: 76 IGENVTSVKVGDLVSAETHIVCGKCRACRTGNAHICE---NTLILGVDTDG--------- 123 +GE VTSV VGD V CG+C+ C++G ++C+ T G+ DG Sbjct: 71 VGEGVTSVAVGDHVIPLYTPECGECKFCKSGKTNLCQAIRATQGKGLMPDGTSRFSLNGQ 130 Query: 124 ---------AFAEYIKVPESNV-WINDKNIPLEILSIQEPLGNAVHTVFSGDVV--GKSV 171 F+EY +PE + IN ++ + + + V + V G +V Sbjct: 131 PIYHFMGTSTFSEYTVLPEIAIAKINPAAALDKVCLLGCGITTGIGAVLNTAKVEPGSTV 190 Query: 172 AVIGCGPIGMMAIPLLKRTGAAAIFAIEPADYRRELAHKLGATRVINPLRED--VVSIIK 229 AV G G +G+ I A+ I AI+ + E A +LGAT INP D + +I Sbjct: 191 AVFGLGGVGLSVIQGAVLAKASRILAIDINPDKAEFAKQLGATDFINPKDYDRPIQEVIV 250 Query: 230 SETEGYGADVVLDFSGNPTAIRQGLEYIAKG-GRMSILGLPD-----NEVPIDITNNVVF 283 T+G G D + GN +R LE KG G +I+G+ + P + V+ Sbjct: 251 ELTDG-GVDYSFEAIGNVNTMRAALESCHKGWGESTIIGVAGAGQEISTRPFQLVTGRVW 309 Query: 284 KGITIQGITGRRMYDTWYTVKGLLKSGLAEDLKPIITHTFPLTEYQKGMELMIKGQCGKV 343 +G G+ GR + V+ L + D +T T PL E + E M G+ + Sbjct: 310 RGSAFGGVKGRSQLPGY--VEQYLNGQIKVD--EFVTETRPLEEINEAFEDMHAGKVIRT 365 Query: 344 VL 345 V+ Sbjct: 366 VI 367 Lambda K H 0.319 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 369 Length adjustment: 29 Effective length of query: 318 Effective length of database: 340 Effective search space: 108120 Effective search space used: 108120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory