Align Deoxyribose-phosphate aldolase; DERA; EC 4.1.2.4; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase (uncharacterized)
to candidate Synpcc7942_0983 Synpcc7942_0983 deoxyribose-phosphate aldolase
Query= curated2:Q5N4L8 (228 letters) >FitnessBrowser__SynE:Synpcc7942_0983 Length = 228 Score = 454 bits (1167), Expect = e-133 Identities = 228/228 (100%), Positives = 228/228 (100%) Query: 1 MAELSSDFDLAPYIEHSLLDPAATLEQIDQLCQEADRYHFAAVCLFPWVVRQAREWLNGR 60 MAELSSDFDLAPYIEHSLLDPAATLEQIDQLCQEADRYHFAAVCLFPWVVRQAREWLNGR Sbjct: 1 MAELSSDFDLAPYIEHSLLDPAATLEQIDQLCQEADRYHFAAVCLFPWVVRQAREWLNGR 60 Query: 61 SPRLCTVIDFPNGASTAASKVYAAQEAVENGAQELNVVVNLGWLRSDRADLVHQELAEIV 120 SPRLCTVIDFPNGASTAASKVYAAQEAVENGAQELNVVVNLGWLRSDRADLVHQELAEIV Sbjct: 61 SPRLCTVIDFPNGASTAASKVYAAQEAVENGAQELNVVVNLGWLRSDRADLVHQELAEIV 120 Query: 121 EATGVPIKAILEATRLNPSELEQLTDLCLDAGVTMLQTSTGWFGGATPALVQQLRQLTRN 180 EATGVPIKAILEATRLNPSELEQLTDLCLDAGVTMLQTSTGWFGGATPALVQQLRQLTRN Sbjct: 121 EATGVPIKAILEATRLNPSELEQLTDLCLDAGVTMLQTSTGWFGGATPALVQQLRQLTRN 180 Query: 181 RVGIHAAGGIRTWDQAAALVEAGAIRLGTSYGPMILQQRLAASTPAPA 228 RVGIHAAGGIRTWDQAAALVEAGAIRLGTSYGPMILQQRLAASTPAPA Sbjct: 181 RVGIHAAGGIRTWDQAAALVEAGAIRLGTSYGPMILQQRLAASTPAPA 228 Lambda K H 0.319 0.132 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 228 Length adjustment: 23 Effective length of query: 205 Effective length of database: 205 Effective search space: 42025 Effective search space used: 42025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
Align candidate Synpcc7942_0983 Synpcc7942_0983 (deoxyribose-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00126.hmm # target sequence database: /tmp/gapView.18656.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00126 [M=211] Accession: TIGR00126 Description: deoC: deoxyribose-phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-67 212.9 0.0 2.1e-67 212.7 0.0 1.0 1 lcl|FitnessBrowser__SynE:Synpcc7942_0983 Synpcc7942_0983 deoxyribose-phos Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SynE:Synpcc7942_0983 Synpcc7942_0983 deoxyribose-phosphate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 212.7 0.0 2.1e-67 2.1e-67 2 209 .. 10 215 .. 9 217 .. 0.98 Alignments for each domain: == domain 1 score: 212.7 bits; conditional E-value: 2.1e-67 TIGR00126 2 lakliDhtalkadtteedietlcaeAkkykfaavcvnpsyvslAkelLkgteveictvvgFPlGastte 70 la +i+h+ l++++t e+i++lc+eA +y+faavc+ p +v++A+e L+g + ++ctv++FP Gast lcl|FitnessBrowser__SynE:Synpcc7942_0983 10 LAPYIEHSLLDPAATLEQIDQLCQEADRYHFAAVCLFPWVVRQAREWLNGRSPRLCTVIDFPNGASTAA 78 899****************************************************************** PP TIGR00126 71 vkllEakeaieeGAdEvDvviniaalkdkneevviedikavveacakvllKvilEtalLtdeekkkAse 139 +k++ a+ea+e+GA+E++vv+n+++l++++ ++v ++++ +vea+ +v++K+ilE ++L +e+++ ++ lcl|FitnessBrowser__SynE:Synpcc7942_0983 79 SKVYAAQEAVENGAQELNVVVNLGWLRSDRADLVHQELAEIVEAT-GVPIKAILEATRLNPSELEQLTD 146 *********************************************.*********************** PP TIGR00126 140 isieagadfvKtstgfsakgAtvedvrlmkkvvgdevgvKasGGvrtaedalalieagaerigasaava 208 ++++ag+ ++tstg+ +gAt++ v+ +++ +++vg+ a+GG+rt ++a al+eaga r+g+s + lcl|FitnessBrowser__SynE:Synpcc7942_0983 147 LCLDAGVTMLQTSTGWF-GGATPALVQQLRQLTRNRVGIHAAGGIRTWDQAAALVEAGAIRLGTSYGPM 214 ****************8.***********************************************9866 PP TIGR00126 209 i 209 i lcl|FitnessBrowser__SynE:Synpcc7942_0983 215 I 215 5 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (228 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.73 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory