Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate Synpcc7942_0960 Synpcc7942_0960 ATPase
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__SynE:Synpcc7942_0960 Length = 417 Score = 284 bits (726), Expect = 4e-81 Identities = 169/407 (41%), Positives = 238/407 (58%), Gaps = 58/407 (14%) Query: 7 DNIYKRYPNAKHYS-------VENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITE 59 + I KR+P + NL+I D EF+V VGPSGCGKST LR++AGLE + Sbjct: 29 EEIEKRFPEQARSPQKGEVVVLNGINLEIADGEFMVVVGPSGCGKSTLLRLLAGLETPSR 88 Query: 60 GNLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLR-------------- 105 G + + D+ ++ K RDIAMVFQ+YALYPH+SVY+N+AFGL+ + Sbjct: 89 GLIKVGDRRVDRLPAKARDIAMVFQSYALYPHLSVYDNLAFGLRRQGDRPWWQQQLALAT 148 Query: 106 -------KYKKDD---INKRVHEAAEILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAK 155 +Y+ + I +RV E A +L L L+R+P LSGGQ+QRVA+GRAI R+ + Sbjct: 149 RSLPKSLQYEPEQEARIKRRVREVATMLQLDTLLDRQPKQLSGGQKQRVALGRAIARNPQ 208 Query: 156 VFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNP 215 VFLMDEPLSNLDAKLR RA+I + R++G TT+YVTHDQTEAMT+ DRI +++ Sbjct: 209 VFLMDEPLSNLDAKLRAETRAQIVSLQRQLGVTTLYVTHDQTEAMTMGDRIAVLNR---- 264 Query: 216 DKTGSIGRIEQIGTPQELYNEPANKFVAGFIGSPAMNFFEVTVEKERLVNQDGLSLALPQ 275 G ++Q+ +P E+Y+ PAN+FVA FIGSP MN VTV + + LP+ Sbjct: 265 ------GHLQQVASPLEIYDRPANRFVAQFIGSPPMNLIPVTVRAPLQLTTENFRCTLPE 318 Query: 276 GQEKILEEKGYLGKKVTLGIRPEDISSDQIVHETFPNASVTADILVS----ELLGSESML 331 E +L + Y G+ V LGIRPE + A+ + ++L++ E LGS++ + Sbjct: 319 AWEPVL--RLYDGQTVELGIRPEHLE---------VGAAASKNLLITVTGVEALGSDTFI 367 Query: 332 --YVKFGSTEFTARVNARDSHSPGEKVQLTFNIAKGHFFDLETEKRI 376 +K AR+ + G+++ LTF + H FDLET K I Sbjct: 368 AGELKESGIAVQARLAPQQCWQMGDRLWLTFKPDQIHLFDLETGKAI 414 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 375 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 417 Length adjustment: 31 Effective length of query: 346 Effective length of database: 386 Effective search space: 133556 Effective search space used: 133556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory