Align Maltose transport system permease protein malF aka TT_C1628, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate Synpcc7942_0526 Synpcc7942_0526 ABC-type sugar transport systems permease components-like
Query= TCDB::Q72H67 (291 letters) >FitnessBrowser__SynE:Synpcc7942_0526 Length = 293 Score = 165 bits (417), Expect = 1e-45 Identities = 95/286 (33%), Positives = 155/286 (54%), Gaps = 4/286 (1%) Query: 1 MLTLRQVRLAWILVLPTLLVVVLVAGYPLAQVFYWSFFKADIAFVEPPEFVGLENYAYLF 60 M LR ++ + P L ++ L +P Q FY+SF + D P++VGLEN+ L Sbjct: 1 MTALRDRLSPYLFLAPALTILGLTVFWPALQAFYFSFTRFDYNLTRSPQWVGLENFQRLL 60 Query: 61 QDPDFRQALWNTLKFTVVSVSLETVLGLAIALIIHSNFRGRGLVRTAILIPWAIPTVVSA 120 D F + L NT + + V L L L +A++++ RG L R A P + VV+ Sbjct: 61 NDAVFWKTLGNTFIYLIGVVPLLVFLPLGLAILVNRPLRGITLFRLAYYTPVIVSIVVAG 120 Query: 121 KMWQWMLNDVYGVINVLG-VKLGLLSQKVAFLARPELLLPSIIAVDVWKTTPFMALLLLA 179 W+W+ + G++N LG + G Q + +L P L L S++AV VWK + ++ LA Sbjct: 121 IAWRWLYAET-GLLNQLGQLVFGEGFQPIPWLTSPALALFSVMAVTVWKGLGYYMVIYLA 179 Query: 180 GLQMIPEELYEAASIDGASRWQQFWSITLPLLTPALVVALIFRTLDALRVFDVVFVMSGV 239 GLQ IP ELYEAA++DG+ W++ ITLPL+ P LV+ + + A +VF+ VF+M+ Sbjct: 180 GLQGIPLELYEAAALDGSDGWRRHLDITLPLMRPYLVLVAVISAISATKVFEEVFIMTQG 239 Query: 240 NP--ATRTLAVYNRQTLVDFQDLGYGSAISVAILVIIFAFVLLYMR 283 P +++T+ Y Q ++ Y + +A+ +++ LL +R Sbjct: 240 GPLNSSKTVVYYVYQQAFQKLEVSYACTVGLALFLVVLTLSLLRLR 285 Lambda K H 0.329 0.142 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 291 Length of database: 293 Length adjustment: 26 Effective length of query: 265 Effective length of database: 267 Effective search space: 70755 Effective search space used: 70755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory