Align TreT, component of Trehalose porter (characterized)
to candidate Synpcc7942_0949 Synpcc7942_0949 permease protein of sugar ABC transporter
Query= TCDB::Q97ZC2 (275 letters) >FitnessBrowser__SynE:Synpcc7942_0949 Length = 292 Score = 117 bits (293), Expect = 3e-31 Identities = 81/276 (29%), Positives = 136/276 (49%), Gaps = 11/276 (3%) Query: 11 LVLPALAYVISFAFFPTIEAVYLSFQDPHGG-------FSLYNYKEL-SYFNLSSAIINT 62 L +PAL + +P + A +LS Q + L NY+ L + NT Sbjct: 8 LTIPALLTITGVFAYPLLRAAWLSLQALNLNTQLQPVFIGLANYQRLWGDSRFWGDLFNT 67 Query: 63 IVVTIGALAIQLALGFLVASVLSREFFGKRALSTITIIPMGIATVVAAVTFSFVFQTSGG 122 V T+ +++++L LG +A +L + + L TI ++P + T V A+ ++++F G Sbjct: 68 TVFTVTSVSLELVLGLAIALLLHQPSRWRGPLRTIALLPWVLPTAVMALGWAWIFNDPYG 127 Query: 123 YANTILHSL--FGLNVNWYQSSISSLLVVMIADSWKNTPIVALILLAGMSSIPKELYYAS 180 N L L +NW + + L ++ AD WK TP VA++LLAG +IP++LY A Sbjct: 128 VWNDWLQQLGWIAAPINWLGNPRWAWLTLVAADVWKTTPFVAILLLAGRQAIPEDLYEAH 187 Query: 181 AIDGAGPIRRFFYITLPNLRSFIGISLILRGVQEFNIFALPLILIGEHPPLLT-TLIYDL 239 ++GA + F+ ITLP LR + I+L+ R Q F +F L ++ G P T TL Sbjct: 188 CLEGATAWQSFWQITLPLLRPQLAIALLFRSAQAFGLFDLVKVMTGGGPANSTETLALYA 247 Query: 240 YTTTFPEVGLALASATILLGFILVFSGIVIKLSGGR 275 YTT + + ++ ++ +G+ + GR Sbjct: 248 YTTALRYLDFGYGATLAIVTAAILAAGLGLIWGLGR 283 Lambda K H 0.328 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 292 Length adjustment: 26 Effective length of query: 249 Effective length of database: 266 Effective search space: 66234 Effective search space used: 66234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory