Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate Synpcc7942_1639 Synpcc7942_1639 ATPase
Query= uniprot:P40735 (281 letters) >FitnessBrowser__SynE:Synpcc7942_1639 Length = 213 Score = 124 bits (311), Expect = 2e-33 Identities = 76/205 (37%), Positives = 111/205 (54%), Gaps = 13/205 (6%) Query: 25 LDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRKK 84 L LQ+ GE+ ++G NGSGKSTL R + GL+ +SG I + Sbjct: 15 LQDCDLQIPRGEFWMLLGDNGSGKSTLLRLIAGLLPLQSGTIACD-------------RP 61 Query: 85 IGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHLS 144 +G VFQNPD+Q V TV DVAFGL G+ + ERV A+ V + + + + LS Sbjct: 62 LGFVFQNPDHQLVMPTVGADVAFGLVEEGLSVTQAQERVAEALAAVRLAHYERRPIYALS 121 Query: 145 GGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATVISITHDLN 204 GGQKQRVAIAG IA ++++ DE T++LD + ++++ V+ L T + +TH L Sbjct: 122 GGQKQRVAIAGAIARHCELLLFDEPTALLDSDSQRDLVQQVQQLVRDRGLTALWVTHRLE 181 Query: 205 EAAKADRIIVMNGGKKYAEGPPEEI 229 E AD ++ G+ A G E + Sbjct: 182 ELEAADGACLLQQGRVVATGSVETV 206 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 213 Length adjustment: 24 Effective length of query: 257 Effective length of database: 189 Effective search space: 48573 Effective search space used: 48573 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory