Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate Synpcc7942_0947 Synpcc7942_0947 ATPase
Query= reanno::Dino:3607124 (338 letters) >FitnessBrowser__SynE:Synpcc7942_0947 Length = 355 Score = 261 bits (668), Expect = 1e-74 Identities = 138/342 (40%), Positives = 213/342 (62%), Gaps = 14/342 (4%) Query: 4 IKIDKINKFYGTTQA-LFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEI 62 +++ ++ K Y + + +++L ++ GEF+ +GPSGCGKST LR +AGL+ +SG I + Sbjct: 6 LELRQLRKAYSPSVVPVANLSLQLQPGEFLTLLGPSGCGKSTTLRLIAGLDQPTSGSIWL 65 Query: 63 GGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAARVLQ 122 G R++TT+ P DRD+AMVFQSYALYPH+ VR+N+ G+++ ++R+ + A L+ Sbjct: 66 GDREITTLPPGDRDMAMVFQSYALYPHLNVRQNLTLGLQIRRTSAAEIEQRLQQVAHNLE 125 Query: 123 LEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEGLHKQ 182 L+ LDR+P QLSGGQRQRVA+GRA+V+ PSVFL DEPLSNLDA LR Q+R +++ L Q Sbjct: 126 LDHLLDRRPAQLSGGQRQRVALGRALVRQPSVFLLDEPLSNLDALLREQVRAQMKALFSQ 185 Query: 183 LGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEFIGSPAMN-- 240 + ++YVTHDQ EA++++ +I +LN G ++Q+ SP +Y P + FVA FIGSP MN Sbjct: 186 QASPVVYVTHDQTEALSLSHRIAILNGGHLQQLDSPDRIYQAPANAFVAGFIGSPRMNLL 245 Query: 241 ---VFSSDVGLQDISLD-------ASAAFVGCRPEHIEI-VPDGDGHIAATVHVKERLGG 289 + S L +L S G RPEH+++ P+ + I +H+ E LG Sbjct: 246 PLPIHSGQAWLGSRALPIPSHLAARSQVLWGLRPEHLKLATPEVERAIPVQLHLTENLGM 305 Query: 290 ESLLYLGLKGGGQIVARVGGDDETKVGAAVSLRFSRHRLHQF 331 + LL + + ++ R+ + + + + F H F Sbjct: 306 QRLLTVAIAANPEVRLRLLMPSDQPIPTDLQVTFEPESQHWF 347 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 355 Length adjustment: 29 Effective length of query: 309 Effective length of database: 326 Effective search space: 100734 Effective search space used: 100734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory