Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate Synpcc7942_0947 Synpcc7942_0947 ATPase
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__SynE:Synpcc7942_0947 Length = 355 Score = 251 bits (640), Expect = 3e-71 Identities = 147/367 (40%), Positives = 212/367 (57%), Gaps = 24/367 (6%) Query: 4 IHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRI 63 + + L K Y+ + L L + GEF+ LLGPSGCGKST LR+IAGL+ + G++ + Sbjct: 6 LELRQLRKAYSPSVVPVANLSLQLQPGEFLTLLGPSGCGKSTTLRLIAGLDQPTSGSIWL 65 Query: 64 GGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLN 123 G + LP +R++AMVFQ+YALYPH++V N+ GL+ + AAEI++R+++VA L Sbjct: 66 GDREITTLPPGDRDMAMVFQSYALYPHLNVRQNLTLGLQIRRTSAAEIEQRLQQVAHNLE 125 Query: 124 LEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQR 183 L+ LL+R+P +SGGQ+QR A+ RA+++ PSVFL DEPLSNLDA LR Q+R +K L + Sbjct: 126 LDHLLDRRPAQLSGGQRQRVALGRALVRQPSVFLLDEPLSNLDALLREQVRAQMKALFSQ 185 Query: 184 LRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAMNFL 243 + VYVTHDQ EA++L+ R+ ++ G + Q SP +Y+ P N F AGFIG+P MN L Sbjct: 186 QASPVVYVTHDQTEALSLSHRIAILNGGHLQQLDSPDRIYQAPANAFVAGFIGSPRMNLL 245 Query: 244 SGTVQRQDGQLFIETAHQRWALTGERF----SRLRHAMAVKLAVRPDHVRIAGEREPAAS 299 + H A G R S L V +RP+H+++A P Sbjct: 246 PLPI------------HSGQAWLGSRALPIPSHLAARSQVLWGLRPEHLKLA---TPEVE 290 Query: 300 LTCPVSVELVEILGADALLTTRCG---DQTLTALVPADRLPQPGATLTLALDQHELHVFD 356 PV + L E LG LLT + L L+P+D+ P P L + + H F Sbjct: 291 RAIPVQLHLTENLGMQRLLTVAIAANPEVRLRLLMPSDQ-PIP-TDLQVTFEPESQHWFC 348 Query: 357 VESGENL 363 +G+ L Sbjct: 349 PSTGDRL 355 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 355 Length adjustment: 30 Effective length of query: 376 Effective length of database: 325 Effective search space: 122200 Effective search space used: 122200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory