Align SDR family oxidoreductase (characterized, see rationale)
to candidate Synpcc7942_0684 Synpcc7942_0684 3-oxoacyl-[acyl-carrier-protein] reductase
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__SynE:Synpcc7942_0684 Length = 249 Score = 109 bits (273), Expect = 5e-29 Identities = 86/255 (33%), Positives = 127/255 (49%), Gaps = 26/255 (10%) Query: 8 LAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHL--EELASIA--GVETHLL-- 61 L + L+T A++GIGRA A GA+V S E +A+IA G E + Sbjct: 6 LTDRIALVTGASRGIGRAIALELAAAGAKVAVNYASSAGAADEVVAAIAAAGGEAFAVKA 65 Query: 62 DVTDDDAIKALVAKV----GTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTI 117 DV+ + ++AL A V G +DVL N AG +L W +LN +F Sbjct: 66 DVSQESEVEALFAAVIERWGRLDVLVNNAGITRDTLLLRMKRDDWQSVLDLNLGGVFLCS 125 Query: 118 RAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCN 177 RA ML +++G I+NIAS + G + Y A+KA V+GLTK+VA + S+GI N Sbjct: 126 RAAAKIMLKQRSGRIINIASVVGEM-GNPGQANYSAAKAGVIGLTKTVAKELASRGITVN 184 Query: 178 AICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASD- 236 A+ PG I + ++ + + E P+GR G+A EVA + +LA+D Sbjct: 185 AVAPGFIATDMTSELAAEKLLEV--------------IPLGRYGEAAEVAGVVRFLAADP 230 Query: 237 ESNFTTGSIHMIDGG 251 + + TG + IDGG Sbjct: 231 AAAYITGQVINIDGG 245 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 249 Length adjustment: 24 Effective length of query: 230 Effective length of database: 225 Effective search space: 51750 Effective search space used: 51750 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory