GapMind for catabolism of small carbon sources

 

Protein GFF1168 in Pseudomonas simiae WCS417

Annotation: FitnessBrowser__WCS417:GFF1168

Length: 344 amino acids

Source: WCS417 in FitnessBrowser

Candidate for 23 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA med spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) 43% 94% 269.2 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
xylitol catabolism Dshi_0546 med ABC transporter for Xylitol, ATPase component (characterized) 42% 96% 252.3 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 94% 243.4 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 44% 94% 243.4 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-cellobiose catabolism msiK med MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 45% 81% 241.9 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-mannitol catabolism mtlK med SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 42% 97% 241.5 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 41% 94% 236.9 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
trehalose catabolism treV med TreV, component of Trehalose porter (characterized) 44% 86% 236.5 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-cellobiose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 77% 231.5 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-glucose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 77% 231.5 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
lactose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 77% 231.5 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-maltose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 77% 231.5 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
sucrose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 77% 231.5 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
trehalose catabolism gtsD med Sugar ABC transporter ATP-binding protein (characterized, see rationale) 41% 77% 231.5 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 46% 72% 230.7 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 41% 84% 170.6 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 48% 64% 232.6 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 39% 88% 232.6 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 40% 91% 217.6 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 42% 64% 192.2 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 42% 64% 192.2 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 42% 64% 192.2 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 42% 64% 192.2 Uncharacterized ABC transporter ATP-binding protein YdcT 67% 433.0

Sequence Analysis Tools

View GFF1168 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MTLAVQFTHVSRQFGEVKAVDRVSIDIQDGEFFSMLGPSGSGKTTCLRLIAGFEQPSAGS
IRIHGEEAAGLPPYQRDVNTVFQDYALFPHMNVRDNVAYGLKVKGVGKTERMNRAEEALG
MVALGGYGDRKPVQLSGGQRQRVALARALVNRPRVLLLDEPLGALDLKLREQMQSELKKL
QRQLGITFIFVTHDQTEALSMSDRVAVFNKGRIEQVDTPRNLYMKPATSFVAEFVGTSNV
IRGELAQRLGGTAQPFSIRPEHVRFAEGPLGTGEVEISGLLHDIQYQGSATRYELKLENG
QALNISRANNQWLDTTAGHQVGQTLTARWAREAMVPLTDIAGEV

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory